(data stored in ACNUC8465 zone)

EMBL: CU928166.PE240

CU928166.PE240       Location/Qualifiers
FT   CDS             complement(482270..483013)
FT                   /locus_tag="KLTH0B05874g"
FT                   /old_locus_tag="KLTH-ORF15148"
FT                   /product="KLTH0B05874p"
FT                   /note="similar to uniprot|P53904 Saccharomyces cerevisiae
FT                   YNL148C ALF1 alpha-tubulin foldin protein implicated in
FT                   folding of alpha tubulin cofactor B"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05874g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21605"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR036859"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCU4"
FT                   /protein_id="CAR21605.1"
FT                   /translation="MPQIQISSPLCSIVRELSPQWSWPQLCDKLSEITGVLPSDMQINV
FT                   IFKDRTSLLINAPLTEQKPLSSLLSKNAVELQVNDSNASSLANELARDFTEGEQSSEQT
FT                   YHLPEEDYQRRQDSVLQWKKDLQLGKFNPEYQARLQKDCEEQQSRAEELTINERCSVST
FT                   PNLPERRGWLRFVGSLTPLMDEPGIWCGVEFDEPVGKNDGSFKGRYFFGPVRPKYGAFV
FT                   KPSTVKTSAKFSPLLDDIEFSDSEI"
     MPQIQISSPL CSIVRELSPQ WSWPQLCDKL SEITGVLPSD MQINVIFKDR TSLLINAPLT        60
     EQKPLSSLLS KNAVELQVND SNASSLANEL ARDFTEGEQS SEQTYHLPEE DYQRRQDSVL       120
     QWKKDLQLGK FNPEYQARLQ KDCEEQQSRA EELTINERCS VSTPNLPERR GWLRFVGSLT       180
     PLMDEPGIWC GVEFDEPVGK NDGSFKGRYF FGPVRPKYGA FVKPSTVKTS AKFSPLLDDI       240
     EFSDSEI                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page