(data stored in SCRATCH zone)

EMBL: CU928166.PE244

CU928166.PE244       Location/Qualifiers
FT   CDS             complement(486413..488239)
FT                   /locus_tag="KLTH0B05962g"
FT                   /old_locus_tag="KLTH-ORF15141"
FT                   /product="KLTH0B05962p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05962g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21609"
FT                   /db_xref="GOA:C5DCU8"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR018553"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCU8"
FT                   /protein_id="CAR21609.1"
FT                   /translation="MSSKRTLKQILDSEYVEGSDEEADGISNAETAADVDDNEEEVDRS
FT                   FCIDCKDMKTEIICKDCEEHFCVVCFDMIHRSGRRKKHEYVKVSLQPEELPANEQEQQA
FT                   LQNSNNVVSEQNPLAGDGAEPGVTQGVNSLDLKMLAMLAKHARFIPMRLAPEERHLLRL
FT                   LEAALNVSEYTDRVDIISYKSKAKRIVEQLKEMCSVLCGLVIASNLRTGQKLLEMKNFS
FT                   DNAAWFQDVFEIGRRYKIMNPEKMRDTYGKLCYMIMDSRLPQIEEHMEFHLFKPLSTVH
FT                   SFLSSKPEDRGQALKIFEDKLILYATSQISPVGKSRPEINRLIKQKEAAIEKLASKYSS
FT                   RYFSKDDIRQVLYSIGDYNAYINMNRRPIMRMLERLEAFNNPTIATQYPIGIQYGRGGA
FT                   RLTHDHARQMHYVQQSLTLWSVIQREMIHLWYIADQDLYNPNEYRLASTGQGLNRIKAC
FT                   PMLYREMHNILSECRSKCDAWVGSSVVHLGDDAVPNALFFLDKYTQVPNILIPFDQALM
FT                   KINELVDNDPKLLEYIEGEYGSTDGLKLTILQDAFAHMFDGSGADNFYMSGSCIDGRLT
FT                   SAWNHTNMISKKKYYKIFLMTGFIGFNGQDGF"
     MSSKRTLKQI LDSEYVEGSD EEADGISNAE TAADVDDNEE EVDRSFCIDC KDMKTEIICK        60
     DCEEHFCVVC FDMIHRSGRR KKHEYVKVSL QPEELPANEQ EQQALQNSNN VVSEQNPLAG       120
     DGAEPGVTQG VNSLDLKMLA MLAKHARFIP MRLAPEERHL LRLLEAALNV SEYTDRVDII       180
     SYKSKAKRIV EQLKEMCSVL CGLVIASNLR TGQKLLEMKN FSDNAAWFQD VFEIGRRYKI       240
     MNPEKMRDTY GKLCYMIMDS RLPQIEEHME FHLFKPLSTV HSFLSSKPED RGQALKIFED       300
     KLILYATSQI SPVGKSRPEI NRLIKQKEAA IEKLASKYSS RYFSKDDIRQ VLYSIGDYNA       360
     YINMNRRPIM RMLERLEAFN NPTIATQYPI GIQYGRGGAR LTHDHARQMH YVQQSLTLWS       420
     VIQREMIHLW YIADQDLYNP NEYRLASTGQ GLNRIKACPM LYREMHNILS ECRSKCDAWV       480
     GSSVVHLGDD AVPNALFFLD KYTQVPNILI PFDQALMKIN ELVDNDPKLL EYIEGEYGST       540
     DGLKLTILQD AFAHMFDGSG ADNFYMSGSC IDGRLTSAWN HTNMISKKKY YKIFLMTGFI       600
     GFNGQDGF                                                                608
//

If you have problems or comments...

PBIL Back to PBIL home page