(data stored in SCRATCH zone)

EMBL: CU928166.PE247

CU928166.PE247       Location/Qualifiers
FT   CDS             complement(494230..495027)
FT                   /locus_tag="KLTH0B06028g"
FT                   /old_locus_tag="KLTH-ORF15128"
FT                   /product="KLTH0B06028p"
FT                   /note="some similarities with uniprot|P53895 Saccharomyces
FT                   cerevisiae YNL159C ASI2 Predicted membrane protein genetic
FT                   interactions suggest a role in negative regulation of amino
FT                   acid uptake"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06028g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21612"
FT                   /db_xref="GOA:C5DCV1"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCV1"
FT                   /protein_id="CAR21612.1"
FT                   /translation="MTFFMLQKDNANCFKDLDQVLQIKTKSKVKTSCESKKECQGQPIE
FT                   EKMSEDLMHSLQNQNRQQRRAAAMRANPPFRVRVGPRHRQENPFRWPPGVQRRQYLRLF
FT                   LQNLLILDHLLMMVLFPFSVYNVLKILLTEVTFSNSDFVTDIASYCKFSSILSEDGRSV
FT                   ILFKSGFGLLGKFHNIIVYYSAPLFAWLSSNSSVSSFVMRTYTLVVKFTAVVLYTLYGV
FT                   SASTYVCFATFFFSLCLLMTCFRRYKGVAKIVGQLYRTTSGIF"
     MTFFMLQKDN ANCFKDLDQV LQIKTKSKVK TSCESKKECQ GQPIEEKMSE DLMHSLQNQN        60
     RQQRRAAAMR ANPPFRVRVG PRHRQENPFR WPPGVQRRQY LRLFLQNLLI LDHLLMMVLF       120
     PFSVYNVLKI LLTEVTFSNS DFVTDIASYC KFSSILSEDG RSVILFKSGF GLLGKFHNII       180
     VYYSAPLFAW LSSNSSVSSF VMRTYTLVVK FTAVVLYTLY GVSASTYVCF ATFFFSLCLL       240
     MTCFRRYKGV AKIVGQLYRT TSGIF                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page