(data stored in ACNUC8465 zone)

EMBL: CU928166.PE248

CU928166.PE248       Location/Qualifiers
FT   CDS             495028..495585
FT                   /locus_tag="KLTH0B06050g"
FT                   /old_locus_tag="KLTH-ORF15127"
FT                   /product="KLTH0B06050p"
FT                   /note="weakly similar to uniprot|P53896 Saccharomyces
FT                   cerevisiae YNL158W Essential protein of unknown function
FT                   green fluorescent protein (GFP)-fusion protein localizes to
FT                   the nuclear periphery"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06050g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21613"
FT                   /db_xref="GOA:C5DCV2"
FT                   /db_xref="InterPro:IPR019433"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCV2"
FT                   /protein_id="CAR21613.1"
FT                   /translation="MRIVPFFAALAFYICFSLANTESIVFKVPDTFSPAPQPIADENEP
FT                   LISLEGTNRALKTFDAPVDSQFDIELRDLSPGDTFFAKICWTAVDPIDITSLGYSIKPD
FT                   YTARGGHWQDAPLRFFLSFEAKSNSYPLFSKPTVPINISVSAMRMGVPVDLHATIIFMT
FT                   LLTGLIFIINRHYKLYNRFKNV"
     MRIVPFFAAL AFYICFSLAN TESIVFKVPD TFSPAPQPIA DENEPLISLE GTNRALKTFD        60
     APVDSQFDIE LRDLSPGDTF FAKICWTAVD PIDITSLGYS IKPDYTARGG HWQDAPLRFF       120
     LSFEAKSNSY PLFSKPTVPI NISVSAMRMG VPVDLHATII FMTLLTGLIF IINRHYKLYN       180
     RFKNV                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page