(data stored in ACNUC8465 zone)

EMBL: CU928166.PE251

CU928166.PE251       Location/Qualifiers
FT   CDS             complement(497825..498613)
FT                   /locus_tag="KLTH0B06116g"
FT                   /old_locus_tag="KLTH-ORF15122"
FT                   /product="KLTH0B06116p"
FT                   /note="similar to uniprot|P53898 Saccharomyces cerevisiae
FT                   YNL156C NSG2 Protein of unknown function potential homolog
FT                   of mammalian Insig 1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06116g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21616"
FT                   /db_xref="GOA:C5DCV5"
FT                   /db_xref="InterPro:IPR025929"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCV5"
FT                   /protein_id="CAR21616.1"
FT                   /translation="MARKKAQMANGNYSVSSESISNLTRPQLYGIYDADITHSEDAEVY
FT                   EEAKKSVGKFPEDMIKRSGAHGQRSMLQRATHILFSLTFLGVAGISYNELSKQLHDNHE
FT                   LHEEFASRPLALGVEICRTLSFGVVPTWMAYALEGVLFGALLPLMDTLWGSPVRTTTFT
FT                   SFLRSTNAMLGVAFGIRKIEWSSSLQASGAWFLLNIVLWMFFDGTPSMLLGCLGIGTIA
FT                   SVTSYRDVTEFSQMLYFMDFYFLGLLLFGKLGRYLYGHRA"
     MARKKAQMAN GNYSVSSESI SNLTRPQLYG IYDADITHSE DAEVYEEAKK SVGKFPEDMI        60
     KRSGAHGQRS MLQRATHILF SLTFLGVAGI SYNELSKQLH DNHELHEEFA SRPLALGVEI       120
     CRTLSFGVVP TWMAYALEGV LFGALLPLMD TLWGSPVRTT TFTSFLRSTN AMLGVAFGIR       180
     KIEWSSSLQA SGAWFLLNIV LWMFFDGTPS MLLGCLGIGT IASVTSYRDV TEFSQMLYFM       240
     DFYFLGLLLF GKLGRYLYGH RA                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page