(data stored in SCRATCH zone)

EMBL: CU928166.PE255

CU928166.PE255       Location/Qualifiers
FT   CDS             complement(502282..503778)
FT                   /locus_tag="KLTH0B06204g"
FT                   /old_locus_tag="KLTH-ORF15113"
FT                   /product="KLTH0B06204p"
FT                   /note="some similarities with uniprot|P23292 Saccharomyces
FT                   cerevisiae YNL154C YCK2 membrane-bound casein kinase I
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06204g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21620"
FT                   /db_xref="GOA:C5DCV9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCV9"
FT                   /protein_id="CAR21620.1"
FT                   /translation="MNGASASASQHVLGSSASSTARDDSTIVGLHYRIGKKIGEGSFGV
FT                   LFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTPGIPQAYYFGQEGLHNILV
FT                   IDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPG
FT                   TPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDME
FT                   ALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTNVYDLAQGLPVQFGRYLEVVR
FT                   SLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKLNGGRGWDLNINKKPNLHGYGHP
FT                   NPPNDKNRRHRNKYAQGQGMDPQQQLRYQQQQLLHQQQQQQQQQQQQQQQQQQQQQQQR
FT                   QQQLQSQQQISQQQRLDPTSYEAYQQQTQQKYAQQQQKLQQQSRVHSYNQHAPQQQPNL
FT                   YGAQQPPTVKQHAQPPNKVAATDGKSVSSGKGFFSKLGCC"
     MNGASASASQ HVLGSSASST ARDDSTIVGL HYRIGKKIGE GSFGVLFEGT NMINGVPVAI        60
     KFEPRKSEAP QLKDEYRTYK ILAGTPGIPQ AYYFGQEGLH NILVIDLLGP SLEDLFDWCG       120
     RRFSVKTVVQ VAVQMITLIE DLHTHDLIYR DIKPDNFLIG RPGTPDENKV HLIDFGMAKQ       180
     YRDPKTKQHI PYREKKSLSG TARYMSINTH LGREQSRRDD MEALGHVFFY FLRGQLPWQG       240
     LKAPNNKQKY EKIGEKKRVT NVYDLAQGLP VQFGRYLEVV RSLAFEETPD YEGYRKLFLS       300
     ILDDMDNQAD GEYDWMKLNG GRGWDLNINK KPNLHGYGHP NPPNDKNRRH RNKYAQGQGM       360
     DPQQQLRYQQ QQLLHQQQQQ QQQQQQQQQQ QQQQQQQQRQ QQLQSQQQIS QQQRLDPTSY       420
     EAYQQQTQQK YAQQQQKLQQ QSRVHSYNQH APQQQPNLYG AQQPPTVKQH AQPPNKVAAT       480
     DGKSVSSGKG FFSKLGCC                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page