(data stored in ACNUC8465 zone)

EMBL: CU928166.PE257

CU928166.PE257       Location/Qualifiers
FT   CDS             complement(506590..507123)
FT                   /locus_tag="KLTH0B06248g"
FT                   /old_locus_tag="KLTH-ORF15106"
FT                   /product="KLTH0B06248p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06248g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21622"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCW1"
FT                   /protein_id="CAR21622.1"
FT                   /translation="MTSFGTYRTMEDPELLFQFSTPLVGSSRTLPTGISAGEPSSRWPG
FT                   FDASPRAAAADDEERDGDAATLQGSGASICDEAATLYSHTVKRDTPAESGARSEAPWVN
FT                   AAAIGSGYAPHPLKSGTASVYRSNAALLSRFNNALSKSFSSDQLHQIERMVDEFWLRES
FT                   ALTEDMFEDSSDEE"
     MTSFGTYRTM EDPELLFQFS TPLVGSSRTL PTGISAGEPS SRWPGFDASP RAAAADDEER        60
     DGDAATLQGS GASICDEAAT LYSHTVKRDT PAESGARSEA PWVNAAAIGS GYAPHPLKSG       120
     TASVYRSNAA LLSRFNNALS KSFSSDQLHQ IERMVDEFWL RESALTEDMF EDSSDEE          177
//

If you have problems or comments...

PBIL Back to PBIL home page