(data stored in SCRATCH zone)

EMBL: CU928166.PE265

CU928166.PE265       Location/Qualifiers
FT   CDS             complement(518184..520328)
FT                   /locus_tag="KLTH0B06424g"
FT                   /old_locus_tag="KLTH-ORF15072"
FT                   /product="KLTH0B06424p"
FT                   /note="similar to uniprot|P53894 Saccharomyces cerevisiae
FT                   YNL161W CBK1 Protein kinase involved in cell wall
FT                   biosynthesis required for efficient apical growth proper
FT                   mating projection morphology bipolar bud site selection in
FT                   diploid cells and cell separation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06424g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21630"
FT                   /db_xref="GOA:C5DCW9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCW9"
FT                   /protein_id="CAR21630.1"
FT                   /translation="MFGGVNNSYGKPGATYSPGAGKNDSYQSPNRYSAASNGSHNTGSG
FT                   MARPPAAAFSSNYLREQGSHQSLQDHLQKEVPMRGTSPIHGGFTDVPNLNYPSTPTNST
FT                   GFLSAQNPPVLSTPPTSNFGTAQSTYNHNNNSQSNLRNNVFSNPHVSPGQYSLGSDYGA
FT                   ESHTLQSPHAQQQFTPVPPAQSSPVRSLRGVTQPQPLMDQQQRPQNPANPVSNYMYFER
FT                   RPDLLSKSTQDKAATVKLKIENFYQSSVNYAIERNQRRVELESQLVSQDWSDERKSRQL
FT                   STLGKKESQFLRLRRTRLSLEDFQTVKVIGKGAFGEVRLVQKRDTGKIYAMKTLLKSEM
FT                   YKKDQLAHVKAERDVLAGSDSPWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQIF
FT                   TEDVTRFYMAECILAIEAIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDS
FT                   NYYKKLLQQDEVNAASGNLQKPQMGIAAGNDTSNGSNRNTMFVDAIHLTMTNRQQIQTW
FT                   RKSRRLMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQET
FT                   YRKIMNFEQALQFPDDIHISYEAEDLIRRLLTHADQRLGRHGGADEIKNHPFFRGVDWN
FT                   TIRQVEAPYIPKLSSITDTRFFPTDELENVPDSPAMAQAARQREQMMKQGVTGSASKED
FT                   LPFIGYTYSRFDYLTRKNAL"
     MFGGVNNSYG KPGATYSPGA GKNDSYQSPN RYSAASNGSH NTGSGMARPP AAAFSSNYLR        60
     EQGSHQSLQD HLQKEVPMRG TSPIHGGFTD VPNLNYPSTP TNSTGFLSAQ NPPVLSTPPT       120
     SNFGTAQSTY NHNNNSQSNL RNNVFSNPHV SPGQYSLGSD YGAESHTLQS PHAQQQFTPV       180
     PPAQSSPVRS LRGVTQPQPL MDQQQRPQNP ANPVSNYMYF ERRPDLLSKS TQDKAATVKL       240
     KIENFYQSSV NYAIERNQRR VELESQLVSQ DWSDERKSRQ LSTLGKKESQ FLRLRRTRLS       300
     LEDFQTVKVI GKGAFGEVRL VQKRDTGKIY AMKTLLKSEM YKKDQLAHVK AERDVLAGSD       360
     SPWVVSLYYS FQDTQYLYLI MEFLPGGDLM TMLIRWQIFT EDVTRFYMAE CILAIEAIHK       420
     LGFIHRDIKP DNILIDIRGH IKLSDFGLST GFHKTHDSNY YKKLLQQDEV NAASGNLQKP       480
     QMGIAAGNDT SNGSNRNTMF VDAIHLTMTN RQQIQTWRKS RRLMAYSTVG TPDYIAPEIF       540
     LYQGYGQECD WWSLGAIMYE CLIGWPPFCS ETPQETYRKI MNFEQALQFP DDIHISYEAE       600
     DLIRRLLTHA DQRLGRHGGA DEIKNHPFFR GVDWNTIRQV EAPYIPKLSS ITDTRFFPTD       660
     ELENVPDSPA MAQAARQREQ MMKQGVTGSA SKEDLPFIGY TYSRFDYLTR KNAL             714
//

If you have problems or comments...

PBIL Back to PBIL home page