(data stored in SCRATCH zone)

EMBL: CU928166.PE266

CU928166.PE266       Location/Qualifiers
FT   CDS             complement(join(520647..520963,521299..521302))
FT                   /locus_tag="KLTH0B06446g"
FT                   /old_locus_tag="Klth0B.mRNA.1227.m"
FT                   /product="KLTH0B06446p"
FT                   /note="highly similar to uniprot|P02405 Saccharomyces
FT                   cerevisiae YHR141C RPL42B and highly similar to
FT                   uniprot|P02405 Saccharomyces cerevisiae YNL162W RPL42A
FT                   Proteins component of the large (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06446g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21631"
FT                   /db_xref="GOA:C5DCX0"
FT                   /db_xref="InterPro:IPR000552"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCX0"
FT                   /protein_id="CAR21631.1"
FT                   /translation="MVNVPKTRRTYCKGKQCRKHTQHKVTQYKAGKASLYAQGKRRYDR
FT                   KQRGFGGQTRPIFHKKAKVTKKVVLRLECVVCKTRAQLALKRCKHFELGGEKKQKGQAL
FT                   QF"
     MVNVPKTRRT YCKGKQCRKH TQHKVTQYKA GKASLYAQGK RRYDRKQRGF GGQTRPIFHK        60
     KAKVTKKVVL RLECVVCKTR AQLALKRCKH FELGGEKKQK GQALQF                      106
//

If you have problems or comments...

PBIL Back to PBIL home page