(data stored in SCRATCH zone)

EMBL: CU928166.PE271

CU928166.PE271       Location/Qualifiers
FT   CDS             528699..529601
FT                   /locus_tag="KLTH0B06556g"
FT                   /old_locus_tag="KLTH-ORF15056"
FT                   /product="KLTH0B06556p"
FT                   /note="some similarities with uniprot|P38844 Saccharomyces
FT                   cerevisiae YHR143W DSE2 daughter-specific expression
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06556g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21636"
FT                   /db_xref="InterPro:IPR026225"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCX5"
FT                   /protein_id="CAR21636.1"
FT                   /translation="MQFKLSTIATALTFLSSMVCADSNVRYITSDGVVYSFAVITSTIK
FT                   PATTYVTTRYYTTTEVVPVTLSNQVVSSSTKAVTKTSTLEVVSSTAPAESSSLTPESTS
FT                   TLSSSQQPDTTSSQSQSSNTRSTLSTAIQSSSAASASSTFSLISSSIPASSSPRSTFVS
FT                   STDVSSSVSSATYSASSASSSSSSSAIASSTSSAFSSTSNTPGISSSSASATSASSASK
FT                   SSSTITKSSPSVTSIASSTLSLEGEAFTTEYDEDGSCTVYYEDDDDYYTTVYLTDSSQS
FT                   VDAYTTYTSTRTVYETIST"
     MQFKLSTIAT ALTFLSSMVC ADSNVRYITS DGVVYSFAVI TSTIKPATTY VTTRYYTTTE        60
     VVPVTLSNQV VSSSTKAVTK TSTLEVVSST APAESSSLTP ESTSTLSSSQ QPDTTSSQSQ       120
     SSNTRSTLST AIQSSSAASA SSTFSLISSS IPASSSPRST FVSSTDVSSS VSSATYSASS       180
     ASSSSSSSAI ASSTSSAFSS TSNTPGISSS SASATSASSA SKSSSTITKS SPSVTSIASS       240
     TLSLEGEAFT TEYDEDGSCT VYYEDDDDYY TTVYLTDSSQ SVDAYTTYTS TRTVYETIST       300
//

If you have problems or comments...

PBIL Back to PBIL home page