(data stored in SCRATCH zone)

EMBL: CU928166.PE273

CU928166.PE273       Location/Qualifiers
FT   CDS             531018..532247
FT                   /locus_tag="KLTH0B06600g"
FT                   /old_locus_tag="KLTH-ORF15052"
FT                   /product="KLTH0B06600p"
FT                   /note="weakly similar to uniprot|P53890 Saccharomyces
FT                   cerevisiae YNL166C BNI5 Protein involved in organization of
FT                   septins at the mother-bud neck may interact directly with
FT                   the Cdc11p septin localizes to bud neck in a septin-
FT                   dependent manner"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06600g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21638"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCX7"
FT                   /protein_id="CAR21638.1"
FT                   /translation="MDQETLRKRMSQIELEIDEMNQVIDENLQLAEPHGDEPPEHEKKK
FT                   RWDSGTSKDPETGPEEPETQQVIEAELFLRSATRPVPPSIPAATELGKEQRTKPALENE
FT                   PTHSEHMNQPPAERVPLEQTPSDGGVSLAPSQYVDAPEAVPAQSSSKSEAAPADIGLRE
FT                   TQPLNGISSRQAGSVGSAGSPRESQPSTETAETPSSEVDREQPDEHLQPPSEEFTTTAS
FT                   RGFKAASREDARKEMPQQSTLGNNEPQEASAGMSFDENSPSTQSSAGSKQPVSPDSTQS
FT                   SPQLNLPKTRNPAFPGKRATSNPNPFRVVSVTSKQTEDVSPAQKLQTRHDYLARKCIKL
FT                   QREIQYLSDLRDRGAVAPEDARKINSALEKLQEYLDLKTKERYEIGVLLSRQLRREIDR
FT                   GENGQFWVGH"
     MDQETLRKRM SQIELEIDEM NQVIDENLQL AEPHGDEPPE HEKKKRWDSG TSKDPETGPE        60
     EPETQQVIEA ELFLRSATRP VPPSIPAATE LGKEQRTKPA LENEPTHSEH MNQPPAERVP       120
     LEQTPSDGGV SLAPSQYVDA PEAVPAQSSS KSEAAPADIG LRETQPLNGI SSRQAGSVGS       180
     AGSPRESQPS TETAETPSSE VDREQPDEHL QPPSEEFTTT ASRGFKAASR EDARKEMPQQ       240
     STLGNNEPQE ASAGMSFDEN SPSTQSSAGS KQPVSPDSTQ SSPQLNLPKT RNPAFPGKRA       300
     TSNPNPFRVV SVTSKQTEDV SPAQKLQTRH DYLARKCIKL QREIQYLSDL RDRGAVAPED       360
     ARKINSALEK LQEYLDLKTK ERYEIGVLLS RQLRREIDRG ENGQFWVGH                   409
//

If you have problems or comments...

PBIL Back to PBIL home page