(data stored in ACNUC8465 zone)

EMBL: CU928166.PE274

CU928166.PE274       Location/Qualifiers
FT   CDS             532482..532694
FT                   /locus_tag="KLTH0B06622g"
FT                   /old_locus_tag="KLTH-ORF15048"
FT                   /product="KLTH0B06622p"
FT                   /note="highly similar to uniprot|P40422 Saccharomyces
FT                   cerevisiae YHR143W-A RPC10 RNA polymerase subunit ABC10-
FT                   alpha common to RNA polymerases I II and III"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06622g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21639"
FT                   /db_xref="GOA:C5DCX8"
FT                   /db_xref="InterPro:IPR006591"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="InterPro:IPR039747"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCX8"
FT                   /protein_id="CAR21639.1"
FT                   /translation="MSREGFQIPTNLDAAAAGTAAARTATLKYICAECSSKLSLSRTDP
FT                   VRCKDCGHRILLKARTKRMVQFEAR"
     MSREGFQIPT NLDAAAAGTA AARTATLKYI CAECSSKLSL SRTDPVRCKD CGHRILLKAR        60
     TKRMVQFEAR                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page