(data stored in ACNUC8465 zone)

EMBL: CU928166.PE276

CU928166.PE276       Location/Qualifiers
FT   CDS             538970..540142
FT                   /locus_tag="KLTH0B06710g"
FT                   /old_locus_tag="KLTH-ORF15038"
FT                   /product="KLTH0B06710p"
FT                   /note="weakly similar to uniprot|P38723 Saccharomyces
FT                   cerevisiae YHL048W COS8 Nuclear membrane protein member of
FT                   a family of conserved often subtelomerically-encoded
FT                   proteins regulation suggests a potential role in the
FT                   unfolded protein response"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06710g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21641"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCY0"
FT                   /protein_id="CAR21641.1"
FT                   /translation="MRGTFKEDPEAHELRNPKTHYRNKASWELAQMATGLSIPKWMSSG
FT                   LIICMFIAAHDVYYERAPARSWHRQQLYNVLLSSFAMLFESPYQKIKRTIKLQMEQLCR
FT                   EVLEGNPGMQIEQWDLVAQRLNDFLHAEGHWPVTNPLFDGHMCHSLFRKLVVHPVNKKL
FT                   LATRVQRATVDAREGELSTRTSAASEPAKDTIACYESGMREWWARNAKPEKQEGIDVAC
FT                   RKLPKEVVWSKVGWQFSVAMAALVQTRAFIPISFLSFIGLGTVYSIDTIFRLTPVVLSN
FT                   VFWGIILSPALRDTDVNARDLMELWATIVAVEPRGDTSEWDRVASHMNKYLVTASAAGR
FT                   AAQFYDGENCMQRFKKWYSASLLPKEGQVDARFEDLQPYIEAAMDAASED"
     MRGTFKEDPE AHELRNPKTH YRNKASWELA QMATGLSIPK WMSSGLIICM FIAAHDVYYE        60
     RAPARSWHRQ QLYNVLLSSF AMLFESPYQK IKRTIKLQME QLCREVLEGN PGMQIEQWDL       120
     VAQRLNDFLH AEGHWPVTNP LFDGHMCHSL FRKLVVHPVN KKLLATRVQR ATVDAREGEL       180
     STRTSAASEP AKDTIACYES GMREWWARNA KPEKQEGIDV ACRKLPKEVV WSKVGWQFSV       240
     AMAALVQTRA FIPISFLSFI GLGTVYSIDT IFRLTPVVLS NVFWGIILSP ALRDTDVNAR       300
     DLMELWATIV AVEPRGDTSE WDRVASHMNK YLVTASAAGR AAQFYDGENC MQRFKKWYSA       360
     SLLPKEGQVD ARFEDLQPYI EAAMDAASED                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page