(data stored in SCRATCH zone)

EMBL: CU928166.PE277

CU928166.PE277       Location/Qualifiers
FT   CDS             541428..543518
FT                   /locus_tag="KLTH0B06732g"
FT                   /old_locus_tag="KLTH-ORF15034"
FT                   /product="KLTH0B06732p"
FT                   /note="some similarities with uniprot|Q02100 Saccharomyces
FT                   cerevisiae YNL167C SKO1 Basic leucine zipper (bZIP)
FT                   transcription factor of the ATF/CREB family that forms a
FT                   complex with Tup1p and Ssn6p to both activate and repress
FT                   transcription cytosolic and nuclear protein involved in the
FT                   osmotic and oxidative stress responses"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06732g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21642"
FT                   /db_xref="GOA:C5DCY1"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR020956"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCY1"
FT                   /protein_id="CAR21642.1"
FT                   /translation="MNECQTGTALQRKCHAHSYWLRHTLALITRSSSPTGQLGTYCSAK
FT                   HVPASTVLSSSARTDYRVAPERAQLSATRSSLPAARAQETVAATYRQAQPVTSPSAMRA
FT                   SDPPANDASLVSSFDLEPNPFEQSFASSDKPHGAGGAGVAGHQQVQRARQQSQSQSQSQ
FT                   PQSQPQSQPQLQGQSQQPTPSQPTLPSVHSAQSAASAQPKLPVIPTTPGGSRRLPPLLL
FT                   ANPAPAPATATTAVTATNALATPSAPQHGASAGGSQQAPQVPQASAGSATPGFFINLSK
FT                   TGLTPNESGLRTGLTPGILTAAAPPHPPPPVSLPSGQFTPGLSSLLGLPLGQQPGQQQQ
FT                   AAQQPQQPQQTQQVSQQPAQQQQQQQQQQQQQQQQQQQQQQLPPHPAMSWSHSSSTAVS
FT                   SDPSTTSSQNVKPRNNTSSSSSSSLAQDGTSALSLSEPAQKRQKLSSALPAKKPKNSEP
FT                   SPLDVKDEQERKRKEFLERNRVAASKFRKRKKEYIKKIESDLQFYEAEYDDLSQCMDKL
FT                   CGISKQTINSSLVGMLKQALLRHDVTSSLTVCNHIEQVLLQTKYVQRGGRNPRREEEEK
FT                   RRMESPDADINSDSTYPRRASLATASTDGYHTSQLQPHQLQSHIRPDAGPQLSAADHAT
FT                   GTINNLPLVINGNTLLGLGDIQDPSHNAGAGTVTMSRPTSLTSLQPENNRSVPLHEYPN
FT                   SN"
     MNECQTGTAL QRKCHAHSYW LRHTLALITR SSSPTGQLGT YCSAKHVPAS TVLSSSARTD        60
     YRVAPERAQL SATRSSLPAA RAQETVAATY RQAQPVTSPS AMRASDPPAN DASLVSSFDL       120
     EPNPFEQSFA SSDKPHGAGG AGVAGHQQVQ RARQQSQSQS QSQPQSQPQS QPQLQGQSQQ       180
     PTPSQPTLPS VHSAQSAASA QPKLPVIPTT PGGSRRLPPL LLANPAPAPA TATTAVTATN       240
     ALATPSAPQH GASAGGSQQA PQVPQASAGS ATPGFFINLS KTGLTPNESG LRTGLTPGIL       300
     TAAAPPHPPP PVSLPSGQFT PGLSSLLGLP LGQQPGQQQQ AAQQPQQPQQ TQQVSQQPAQ       360
     QQQQQQQQQQ QQQQQQQQQQ QLPPHPAMSW SHSSSTAVSS DPSTTSSQNV KPRNNTSSSS       420
     SSSLAQDGTS ALSLSEPAQK RQKLSSALPA KKPKNSEPSP LDVKDEQERK RKEFLERNRV       480
     AASKFRKRKK EYIKKIESDL QFYEAEYDDL SQCMDKLCGI SKQTINSSLV GMLKQALLRH       540
     DVTSSLTVCN HIEQVLLQTK YVQRGGRNPR REEEEKRRME SPDADINSDS TYPRRASLAT       600
     ASTDGYHTSQ LQPHQLQSHI RPDAGPQLSA ADHATGTINN LPLVINGNTL LGLGDIQDPS       660
     HNAGAGTVTM SRPTSLTSLQ PENNRSVPLH EYPNSN                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page