(data stored in ACNUC8465 zone)

EMBL: CU928166.PE278

CU928166.PE278       Location/Qualifiers
FT   CDS             543748..544752
FT                   /locus_tag="KLTH0B06754g"
FT                   /old_locus_tag="KLTH-ORF15030"
FT                   /product="KLTH0B06754p"
FT                   /note="similar to uniprot|P53889 Saccharomyces cerevisiae
FT                   YNL168C FMP41 The authentic non-tagged protein was
FT                   localized to mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06754g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21643"
FT                   /db_xref="GOA:C5DCY2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCY2"
FT                   /protein_id="CAR21643.1"
FT                   /translation="MFKVFYILILWFYCFTCFRCAPIRPVGTGRWRLGILRGCTYLGIF
FT                   SRLFGSSHKGSLTTTHQQKLGKGCHQSKMDYSYLKAARKIVCIGRNYAAHVKELNNPFP
FT                   KQPFFFLKPSSSIVTPHDKQAPQETRQHAECSYRGLNADGTNPGAIMIPEGVKVHHEVE
FT                   LALIIGDYISNASPSAFGPKELRRAISGIALSLDLTARNVQDEAKRKGLPWSIGKGFDT
FT                   FLPMSKFIPEARLGKNLDLQDAFRLKCTVNSITRQDGTTGLMLTPLHTIVQHISTMMSL
FT                   EPGDIILTGTPAGVGELKPGDSVYSELFFNGEPLVNMQFDCVKRPGPYVYRET"
     MFKVFYILIL WFYCFTCFRC APIRPVGTGR WRLGILRGCT YLGIFSRLFG SSHKGSLTTT        60
     HQQKLGKGCH QSKMDYSYLK AARKIVCIGR NYAAHVKELN NPFPKQPFFF LKPSSSIVTP       120
     HDKQAPQETR QHAECSYRGL NADGTNPGAI MIPEGVKVHH EVELALIIGD YISNASPSAF       180
     GPKELRRAIS GIALSLDLTA RNVQDEAKRK GLPWSIGKGF DTFLPMSKFI PEARLGKNLD       240
     LQDAFRLKCT VNSITRQDGT TGLMLTPLHT IVQHISTMMS LEPGDIILTG TPAGVGELKP       300
     GDSVYSELFF NGEPLVNMQF DCVKRPGPYV YRET                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page