(data stored in ACNUC8465 zone)

EMBL: CU928166.PE281

CU928166.PE281       Location/Qualifiers
FT   CDS             complement(547625..552751)
FT                   /locus_tag="KLTH0B06820g"
FT                   /old_locus_tag="KLTH-ORF15026"
FT                   /product="KLTH0B06820p"
FT                   /note="similar to uniprot|P53886 Saccharomyces cerevisiae
FT                   YNL172W APC1 Largest subunit of the Anaphase- Promoting
FT                   Complex/Cyclosome (APC/C) which is a ubiquitin- protein
FT                   ligase required for degradation of anaphase inhibitors
FT                   including mitotic cyclins during the metaphase/anaphase
FT                   transition"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06820g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21646"
FT                   /db_xref="GOA:C5DCY5"
FT                   /db_xref="InterPro:IPR024990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCY5"
FT                   /protein_id="CAR21646.1"
FT                   /translation="MPKIPSVFLQNSKHGEVWVFDTRIVEWRLGGKCLRKLEFGGEKVL
FT                   NAGFVDFESVKECLVVVLEDRAHVYYVGKGDFSIVSFPFSVSKAFFHVNGVLLERKLEE
FT                   ENAVGSKSPFAATKHRFITLSDPLNLFGSLVISSNLPEQQDSKATILHFPRAWDDHVSV
FT                   LHDCNAKTLYFYNCKILAPARASGSSSSSKSHNHESAPYPANSRKKSYASLAGDAATYG
FT                   KTSASNKRMLSNEHGSLASSSSSVPHATNAHPNNTATLSTELTNNLRKISIMNRRSASA
FT                   TMGIDLDQPSQTTGPSQSHPGVDYMKRSASATLDRMGSGSALDITPSNSSQFSQELFDH
FT                   AVLTKDVVLTRISQTPLSIDISPNTHVESCRFEDKEAIILHDPDSQWGKIWIFDLNSSM
FT                   TESMKFKAFNNTPIALTKIIDIKWSLIRNYCIHNSKLLPGYLMLLSSSGEEITLYNPFL
FT                   NLTSNPMLIPSREHERALYFSRENLVITSEKASPVNLAILPQIEAVKHCFTAIRYLCDS
FT                   FTYNYILLLWQVARSSVGEKQAACADFTALKLALLSLLQLERCPVNIKAHMEHIRQSPI
FT                   FDARFDGARFLPKIVMGMHLISEEYKLNLLQKQNVEMLEGILYLLTTLMKWPRLWKEFY
FT                   GANEKEDTSFEYKLSNRHFAHPLDEPPSILKSLYSVSDESTIPITPFITFSRLLEDGSS
FT                   VDHIITPRTNKILQLFESLDAIKFSQSNLLDIMNSLNIDSYELETYPLGVFAPLKRVLK
FT                   SVENHVSEVNTGSDFTLIDRPDLQKNQEVLKSVQCDTTQTRKPLQPLVSLGPKGRENSK
FT                   LQGCQPRSIRTIIDDILCLTENQPSDNLSGTNINEEVGEGQVLKRNASLIFSEDRRFFD
FT                   VVELLLYNIPHKLAVLINEKSYTRALKKKRLFSQILALRTFTSGIGWGAVAFSTEKPLA
FT                   TQKWPQPKMNLHCIFTDKTTVTVDPKECDPSLLSWGEFHGGVSSGLRISRKSTGITGSW
FT                   ITFTKPPELNAQHGGFLLGLGLNGHLKNLEEWHVYNYLSPKQTHTSIGLMLGMSASLRG
FT                   TMDLKLTKVLSVHIVALLPHGSSDLNVNYRVQTAGLIGVGLLYQNSQHRRMSDMLFAEV
FT                   SSFVSIDEEAVPDEGYRLAAGIALGLVNIGAGAKAAEAQFKKMAHAETYTSDEDDEDSE
FT                   FAEFRANNGNLDPKIINGLMNIVNSVHDTEESWMPANSQIGAVVALMLIYLKTNNRTVA
FT                   EKLAPSSEEINLKARPYTRPELYMYREWAHHMILWDHIASNTEWLFKGINIACALQVNT
FT                   DFLPIYYCIAGRALALGLKFASSGNSEARDNILALVDKLLPLYQCPIDARLDFQLTIKA
FT                   INVLLNVLLVSVSMIMSGTGDLAVFRRVKFLHETVSGKNSDLFRTPLRKRQQKRNHTED
FT                   EMSVDLTEEPEDGVQAEGNDLGEELEEEEANSTINEELESDDASDESRRYKDEENHFGK
FT                   FMATSLSLGFLFLGSGQYAFKVSKLENLAYLIMSVLPTYMCPYYLQETKHFWSMAVEYR
FT                   SLLVCDSRTGASLNKVPVDVTFKGSKSSNTFSTLKMVSPCLLPDVRLIRSIKILSPDYY
FT                   PVSLDFRSDEDRINFFNNGCVLYVPPREDDGNGWQQNQEAADKSCEVRQILKKKVMSLS
FT                   SPSASTSKSKCTDDILKHLGLANQESLEIENEVLKLKENQDPLLDENLMMSCQNQSKSY
FT                   HLELWRRRHKF"
     MPKIPSVFLQ NSKHGEVWVF DTRIVEWRLG GKCLRKLEFG GEKVLNAGFV DFESVKECLV        60
     VVLEDRAHVY YVGKGDFSIV SFPFSVSKAF FHVNGVLLER KLEEENAVGS KSPFAATKHR       120
     FITLSDPLNL FGSLVISSNL PEQQDSKATI LHFPRAWDDH VSVLHDCNAK TLYFYNCKIL       180
     APARASGSSS SSKSHNHESA PYPANSRKKS YASLAGDAAT YGKTSASNKR MLSNEHGSLA       240
     SSSSSVPHAT NAHPNNTATL STELTNNLRK ISIMNRRSAS ATMGIDLDQP SQTTGPSQSH       300
     PGVDYMKRSA SATLDRMGSG SALDITPSNS SQFSQELFDH AVLTKDVVLT RISQTPLSID       360
     ISPNTHVESC RFEDKEAIIL HDPDSQWGKI WIFDLNSSMT ESMKFKAFNN TPIALTKIID       420
     IKWSLIRNYC IHNSKLLPGY LMLLSSSGEE ITLYNPFLNL TSNPMLIPSR EHERALYFSR       480
     ENLVITSEKA SPVNLAILPQ IEAVKHCFTA IRYLCDSFTY NYILLLWQVA RSSVGEKQAA       540
     CADFTALKLA LLSLLQLERC PVNIKAHMEH IRQSPIFDAR FDGARFLPKI VMGMHLISEE       600
     YKLNLLQKQN VEMLEGILYL LTTLMKWPRL WKEFYGANEK EDTSFEYKLS NRHFAHPLDE       660
     PPSILKSLYS VSDESTIPIT PFITFSRLLE DGSSVDHIIT PRTNKILQLF ESLDAIKFSQ       720
     SNLLDIMNSL NIDSYELETY PLGVFAPLKR VLKSVENHVS EVNTGSDFTL IDRPDLQKNQ       780
     EVLKSVQCDT TQTRKPLQPL VSLGPKGREN SKLQGCQPRS IRTIIDDILC LTENQPSDNL       840
     SGTNINEEVG EGQVLKRNAS LIFSEDRRFF DVVELLLYNI PHKLAVLINE KSYTRALKKK       900
     RLFSQILALR TFTSGIGWGA VAFSTEKPLA TQKWPQPKMN LHCIFTDKTT VTVDPKECDP       960
     SLLSWGEFHG GVSSGLRISR KSTGITGSWI TFTKPPELNA QHGGFLLGLG LNGHLKNLEE      1020
     WHVYNYLSPK QTHTSIGLML GMSASLRGTM DLKLTKVLSV HIVALLPHGS SDLNVNYRVQ      1080
     TAGLIGVGLL YQNSQHRRMS DMLFAEVSSF VSIDEEAVPD EGYRLAAGIA LGLVNIGAGA      1140
     KAAEAQFKKM AHAETYTSDE DDEDSEFAEF RANNGNLDPK IINGLMNIVN SVHDTEESWM      1200
     PANSQIGAVV ALMLIYLKTN NRTVAEKLAP SSEEINLKAR PYTRPELYMY REWAHHMILW      1260
     DHIASNTEWL FKGINIACAL QVNTDFLPIY YCIAGRALAL GLKFASSGNS EARDNILALV      1320
     DKLLPLYQCP IDARLDFQLT IKAINVLLNV LLVSVSMIMS GTGDLAVFRR VKFLHETVSG      1380
     KNSDLFRTPL RKRQQKRNHT EDEMSVDLTE EPEDGVQAEG NDLGEELEEE EANSTINEEL      1440
     ESDDASDESR RYKDEENHFG KFMATSLSLG FLFLGSGQYA FKVSKLENLA YLIMSVLPTY      1500
     MCPYYLQETK HFWSMAVEYR SLLVCDSRTG ASLNKVPVDV TFKGSKSSNT FSTLKMVSPC      1560
     LLPDVRLIRS IKILSPDYYP VSLDFRSDED RINFFNNGCV LYVPPREDDG NGWQQNQEAA      1620
     DKSCEVRQIL KKKVMSLSSP SASTSKSKCT DDILKHLGLA NQESLEIENE VLKLKENQDP      1680
     LLDENLMMSC QNQSKSYHLE LWRRRHKF                                         1708
//

If you have problems or comments...

PBIL Back to PBIL home page