(data stored in ACNUC8465 zone)

EMBL: CU928166.PE285

CU928166.PE285       Location/Qualifiers
FT   CDS             560847..561848
FT                   /locus_tag="KLTH0B06930g"
FT                   /old_locus_tag="KLTH-ORF15004"
FT                   /product="KLTH0B06930p"
FT                   /note="similar to uniprot|P53881 Saccharomyces cerevisiae
FT                   YNL177C MRPL22 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06930g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21650"
FT                   /db_xref="GOA:C5DCY9"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCY9"
FT                   /protein_id="CAR21650.1"
FT                   /translation="MIIKIFEDTSSQPWIAKAGKSRRDKLRGSLNMFPRPLLQCGRFSP
FT                   AVWLRRGFQSSVPALNNGSNGSLFGSITEATEAQNEDPNRISNRLTAASSVAESQESDP
FT                   KETVTVQNDKLLQSFIQRSQPAASAPQLLLSPLKRRIYEENCKMNGGFYKKDSVVTLTG
FT                   EDGKKLKYKLNLSREEMEALEPSIYVKSYRIKSSMKKTTQLLRLLGGLDAKVALTQCHF
FT                   SNKKVARDVAEVLTRGMADAEKLGLKADNLYIAQIWTGSDGYWQKRIDIKARGRNGVIT
FT                   HPYVHVRCILKTKDVTQRRLAYEQMLKQQRSKPWVQLRDQPVRGAMGGVYKW"
     MIIKIFEDTS SQPWIAKAGK SRRDKLRGSL NMFPRPLLQC GRFSPAVWLR RGFQSSVPAL        60
     NNGSNGSLFG SITEATEAQN EDPNRISNRL TAASSVAESQ ESDPKETVTV QNDKLLQSFI       120
     QRSQPAASAP QLLLSPLKRR IYEENCKMNG GFYKKDSVVT LTGEDGKKLK YKLNLSREEM       180
     EALEPSIYVK SYRIKSSMKK TTQLLRLLGG LDAKVALTQC HFSNKKVARD VAEVLTRGMA       240
     DAEKLGLKAD NLYIAQIWTG SDGYWQKRID IKARGRNGVI THPYVHVRCI LKTKDVTQRR       300
     LAYEQMLKQQ RSKPWVQLRD QPVRGAMGGV YKW                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page