(data stored in SCRATCH zone)

EMBL: CU928166.PE288

CU928166.PE288       Location/Qualifiers
FT   CDS             565363..566142
FT                   /locus_tag="KLTH0B06996g"
FT                   /old_locus_tag="KLTH-ORF14991"
FT                   /product="KLTH0B06996p"
FT                   /note="weakly similar to uniprot|P53879 Saccharomyces
FT                   cerevisiae YNL180C RHO5 Non-essential small GTPase of the
FT                   Rho/Rac subfamily of Ras-like proteins likely involved in
FT                   protein kinase C (Pkc1p)-dependent signal transduction
FT                   pathway that controls cell integrity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06996g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21653"
FT                   /db_xref="GOA:C5DCZ2"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ2"
FT                   /protein_id="CAR21653.1"
FT                   /translation="MRSVKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNYTTTIA
FT                   LNDGKSIEPQVFRLNLWDTAGQEEYDRLRPLSYPQTDIFLLCFSINEPNSFMNVKDKWF
FT                   PEIRHNTNYDNLELFRVCGKYPILLVGTKADLRDDEHEQDRLAEVNSDFVSRAEIDQCI
FT                   SQCGFMGYVECSAATQVGVAEVFERAVQCVIIEPERLLNQSKQRESTIDHPTNNQSNTA
FT                   ASSGAGAGTAGSSSNWNAPGSNPMKKRKKKSQKCTIL"
     MRSVKCVIVG DGAVGKTSLL ISYTTNTFPQ DYIPTVFDNY TTTIALNDGK SIEPQVFRLN        60
     LWDTAGQEEY DRLRPLSYPQ TDIFLLCFSI NEPNSFMNVK DKWFPEIRHN TNYDNLELFR       120
     VCGKYPILLV GTKADLRDDE HEQDRLAEVN SDFVSRAEID QCISQCGFMG YVECSAATQV       180
     GVAEVFERAV QCVIIEPERL LNQSKQREST IDHPTNNQSN TAASSGAGAG TAGSSSNWNA       240
     PGSNPMKKRK KKSQKCTIL                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page