(data stored in ACNUC8465 zone)

EMBL: CU928166.PE289

CU928166.PE289       Location/Qualifiers
FT   CDS             complement(566364..567581)
FT                   /locus_tag="KLTH0B07018g"
FT                   /old_locus_tag="KLTH-ORF14989"
FT                   /product="KLTH0B07018p"
FT                   /note="similar to uniprot|P53878 Saccharomyces cerevisiae
FT                   YNL181W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07018g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21654"
FT                   /db_xref="GOA:C5DCZ3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ3"
FT                   /protein_id="CAR21654.1"
FT                   /translation="MPVNIITAGLIEGFDTLPFYRQIKAIAPYAAGVIAVKLWSRGAKN
FT                   TWERNLNGKVYILTGATTQGMGTSVALEMAQKGAQLIILTRVVDEWSTEWVEDLRQRTG
FT                   NELIYLEQCDLSDLYEVRKFATKWLDNSPPRRLDGVVVMSGNLQPAGLVPGWSHGTRKS
FT                   SKDGLELQIATNFAGVFHLLNLLTPSFKAQPPDRDVRIIVTTCMLQAIGEVQVDDPLWE
FT                   DVKYDRPLKFFGSSKLQLSLCMLELQRRILSSTTKDGRSGKNVTVVLAQPGVMRSTSLR
FT                   QLISNGSVFVLVFIYSILLYPLLWLLTKSGYRGAQSILYALTTPELEEINWVDEQVKYV
FT                   VNCSMAKFARKEFADKELQEKLYETTEAKILEVEKKMAVKRNLSKKNTKNDAKGRTKDA
FT                   KGNRKD"
     MPVNIITAGL IEGFDTLPFY RQIKAIAPYA AGVIAVKLWS RGAKNTWERN LNGKVYILTG        60
     ATTQGMGTSV ALEMAQKGAQ LIILTRVVDE WSTEWVEDLR QRTGNELIYL EQCDLSDLYE       120
     VRKFATKWLD NSPPRRLDGV VVMSGNLQPA GLVPGWSHGT RKSSKDGLEL QIATNFAGVF       180
     HLLNLLTPSF KAQPPDRDVR IIVTTCMLQA IGEVQVDDPL WEDVKYDRPL KFFGSSKLQL       240
     SLCMLELQRR ILSSTTKDGR SGKNVTVVLA QPGVMRSTSL RQLISNGSVF VLVFIYSILL       300
     YPLLWLLTKS GYRGAQSILY ALTTPELEEI NWVDEQVKYV VNCSMAKFAR KEFADKELQE       360
     KLYETTEAKI LEVEKKMAVK RNLSKKNTKN DAKGRTKDAK GNRKD                       405
//

If you have problems or comments...

PBIL Back to PBIL home page