(data stored in ACNUC8465 zone)

EMBL: CU928166.PE290

CU928166.PE290       Location/Qualifiers
FT   CDS             567756..569276
FT                   /locus_tag="KLTH0B07040g"
FT                   /old_locus_tag="KLTH-ORF14985"
FT                   /product="KLTH0B07040p"
FT                   /note="similar to uniprot|P53877 Saccharomyces cerevisiae
FT                   YNL182C IPI3 Protein required for cell viability
FT                   computational analysis of large-scale protein- protein
FT                   interaction data suggests a possible role in assembly of
FT                   the ribosomal large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07040g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21655"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ4"
FT                   /protein_id="CAR21655.1"
FT                   /translation="MDEQLIFSTNTTCTVGSLHSPNQTNLKQCSNEFRNGSCLVGSKYL
FT                   LVAQARKALINVYRIEGSGKRESVEQRLPLPETVNCLEVVENNAEQNGNSQLPYLLLAS
FT                   TSSGKLYVWEMASGNLLTVKAMAHYQAITKIRSIIQGKYVITSGADARIMIWQTVDLVS
FT                   QQDPKPLFTLHDHTLAVTDFEVSNAHSSQLSGKLFTVSHDMTMRCYDLNMDVFDKPQLL
FT                   TTFTFPFPLECITLDPADRACYVGGAQGVYALPFYYPIGDRKVANLLSSDSSNILSCVE
FT                   QQPGDKNADLFTMGKVALAKITNAQTSQLACSLEGSLLVVGDSLGKCTVMDVYSKQPVK
FT                   EIQAIVANETAGEVTSIILNPVNVDNSNSLLGDGKTQSGFKIPNLQKNVFAREGLHDIL
FT                   FQIEDLQDSKVAPLDDFEAYLDQVAAEEGTFAQLGNVVSTVKVMSESEGANRNPENPDT
FT                   AQRPADDGELLTMKATVGQLTGAYKELREMYDKLFQEHESLRSTLGEN"
     MDEQLIFSTN TTCTVGSLHS PNQTNLKQCS NEFRNGSCLV GSKYLLVAQA RKALINVYRI        60
     EGSGKRESVE QRLPLPETVN CLEVVENNAE QNGNSQLPYL LLASTSSGKL YVWEMASGNL       120
     LTVKAMAHYQ AITKIRSIIQ GKYVITSGAD ARIMIWQTVD LVSQQDPKPL FTLHDHTLAV       180
     TDFEVSNAHS SQLSGKLFTV SHDMTMRCYD LNMDVFDKPQ LLTTFTFPFP LECITLDPAD       240
     RACYVGGAQG VYALPFYYPI GDRKVANLLS SDSSNILSCV EQQPGDKNAD LFTMGKVALA       300
     KITNAQTSQL ACSLEGSLLV VGDSLGKCTV MDVYSKQPVK EIQAIVANET AGEVTSIILN       360
     PVNVDNSNSL LGDGKTQSGF KIPNLQKNVF AREGLHDILF QIEDLQDSKV APLDDFEAYL       420
     DQVAAEEGTF AQLGNVVSTV KVMSESEGAN RNPENPDTAQ RPADDGELLT MKATVGQLTG       480
     AYKELREMYD KLFQEHESLR STLGEN                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page