(data stored in SCRATCH zone)

EMBL: CU928166.PE291

CU928166.PE291       Location/Qualifiers
FT   CDS             complement(569322..569627)
FT                   /locus_tag="KLTH0B07062g"
FT                   /old_locus_tag="KLTH-ORF14983"
FT                   /product="KLTH0B07062p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07062g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21656"
FT                   /db_xref="GOA:C5DCZ5"
FT                   /db_xref="InterPro:IPR013957"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ5"
FT                   /protein_id="CAR21656.1"
FT                   /translation="MSSQSSPSKEASKPAAASPENPSAEKQKVESKPKGLQPASNESQP
FT                   QPADVASLMGFASFGTTKQKKVQGKGSGGKRVEKTAAKSSRKYRQYVNRKSKKLVQ"
     MSSQSSPSKE ASKPAAASPE NPSAEKQKVE SKPKGLQPAS NESQPQPADV ASLMGFASFG        60
     TTKQKKVQGK GSGGKRVEKT AAKSSRKYRQ YVNRKSKKLV Q                           101
//

If you have problems or comments...

PBIL Back to PBIL home page