(data stored in ACNUC8465 zone)

EMBL: CU928166.PE293

CU928166.PE293       Location/Qualifiers
FT   CDS             571005..573260
FT                   /locus_tag="KLTH0B07106g"
FT                   /old_locus_tag="KLTH-ORF14978"
FT                   /product="KLTH0B07106p"
FT                   /note="similar to uniprot|P22211 Saccharomyces cerevisiae
FT                   YNL183C NPR1 Protein kinase that stabilizes several plasma
FT                   membrane amino acid transporters by antagonizing their
FT                   ubiquitin-mediated degradation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07106g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21658"
FT                   /db_xref="GOA:C5DCZ7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ7"
FT                   /protein_id="CAR21658.1"
FT                   /translation="MSSLTKLLQEKRKNEGGLSSGLAQTRSQMSSAGTAAGTSGGTGSA
FT                   ASEELSSSVGSNVLMNQEAFSSSFFNANSAHTAALSESYKDRDRPAPLTIESRGGNARL
FT                   SSQGFQPGSQPGPQSGPRPVPSLSSSIPYSVPNSNANGSSGSNAAGGAGSGGFHSSNGS
FT                   GVSSASSSWLESPGVMPSNVSAIDSNVISSPKVDTVEPRFVISKQKFQKASMDNAANSY
FT                   SNAQNGSISRSSSISSQLGNLFFTKNGKELSSSQNSQSRDIPTNSAQSAAYGSSIPKPM
FT                   RARRSSLYGSSRQPSNSYQDTFIGSPSSLHEQPPNQYMPRSRHSSIADLKRFFKKGQSV
FT                   NMSVSPGTPPVSSGGNISSHNSNASSFGPGSYSSNNGDTIYTSSASSTLPYSKRYTKTG
FT                   EVLGAGAGGSVRLVKRLQDNKVFAVKEFRTKFESEAKRDYVKKITSEYCIGTTLRHPNI
FT                   IETVEIVYDNNRILQVMEYCDYDLFAIVMSNKMSYEEICCCFKQILTGVQYLHSMGLAH
FT                   RDLKLDNCVINKQGVVKLIDFGAAAVFSYPFSKTLVESSGIVGSDPYLAPEVCIFSKYD
FT                   PRPVDVWSIAIIFACMVLKKFPWKIPKLKDNSFKLFCSGRNCDSLSALVTRTPDPPSYD
FT                   SATNTDENDKPKAEAPVSNNPANPENPNIGPQRLLHSLPEESQHIIGRMVELAPACRVS
FT                   IDDIMKDPWVESIDVCEVVEEGYSTKVVSGVDHKHTQVDQSEAHIAGLEKKKKKQNR"
     MSSLTKLLQE KRKNEGGLSS GLAQTRSQMS SAGTAAGTSG GTGSAASEEL SSSVGSNVLM        60
     NQEAFSSSFF NANSAHTAAL SESYKDRDRP APLTIESRGG NARLSSQGFQ PGSQPGPQSG       120
     PRPVPSLSSS IPYSVPNSNA NGSSGSNAAG GAGSGGFHSS NGSGVSSASS SWLESPGVMP       180
     SNVSAIDSNV ISSPKVDTVE PRFVISKQKF QKASMDNAAN SYSNAQNGSI SRSSSISSQL       240
     GNLFFTKNGK ELSSSQNSQS RDIPTNSAQS AAYGSSIPKP MRARRSSLYG SSRQPSNSYQ       300
     DTFIGSPSSL HEQPPNQYMP RSRHSSIADL KRFFKKGQSV NMSVSPGTPP VSSGGNISSH       360
     NSNASSFGPG SYSSNNGDTI YTSSASSTLP YSKRYTKTGE VLGAGAGGSV RLVKRLQDNK       420
     VFAVKEFRTK FESEAKRDYV KKITSEYCIG TTLRHPNIIE TVEIVYDNNR ILQVMEYCDY       480
     DLFAIVMSNK MSYEEICCCF KQILTGVQYL HSMGLAHRDL KLDNCVINKQ GVVKLIDFGA       540
     AAVFSYPFSK TLVESSGIVG SDPYLAPEVC IFSKYDPRPV DVWSIAIIFA CMVLKKFPWK       600
     IPKLKDNSFK LFCSGRNCDS LSALVTRTPD PPSYDSATNT DENDKPKAEA PVSNNPANPE       660
     NPNIGPQRLL HSLPEESQHI IGRMVELAPA CRVSIDDIMK DPWVESIDVC EVVEEGYSTK       720
     VVSGVDHKHT QVDQSEAHIA GLEKKKKKQN R                                      751
//

If you have problems or comments...

PBIL Back to PBIL home page