(data stored in ACNUC8465 zone)

EMBL: CU928166.PE298

CU928166.PE298       Location/Qualifiers
FT   CDS             complement(583297..584565)
FT                   /locus_tag="KLTH0B07216g"
FT                   /old_locus_tag="KLTH-ORF14957"
FT                   /product="KLTH0B07216p"
FT                   /note="similar to uniprot|P53873 Saccharomyces cerevisiae
FT                   YNL187W Non-essential protein with putative leucine-rich
FT                   nuclear export signal (NES) sequence that fits the
FT                   consensus sequence recognized by Crm1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07216g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21663"
FT                   /db_xref="GOA:C5DD02"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DD02"
FT                   /protein_id="CAR21663.1"
FT                   /translation="MNRVRKVYDTLDTFDGRDVLQSWKREGSRWLDQVENSTYQFPELE
FT                   SSNYERTKGRVPTEHIDLRSPIICTKLSWSQDGTSLVAVFNDYGVRQYLLPEEEGTGLV
FT                   PFKRFFRAQPAVDCCIHPEYSLFNDSDACNVMLASSRDLPIQLLSLSPHAREHRPLFSY
FT                   SVVNAENERFETMFSLSFSHYSGFLAGTSRNKVVAYDLNYKSPIWSSDGYGKPLRGTSA
FT                   RRAIISCFDSPSDSESVLRYAGTYRCDIYGIDLRTKELNFLANKQTLELKENSAGVAEL
FT                   LFSVNKHYLYVIKRNSQTIDVLDARSSFAKINELYLSFRIGSQKIIATLDLINGLLIGT
FT                   HDGKILQWASNMVEFGGLLPRTPEGPAKDSAVSKVFDTSYAGSRINILASSPSNPHLIA
FT                   GSFSPDKFEADHTAKSGLFVVDL"
     MNRVRKVYDT LDTFDGRDVL QSWKREGSRW LDQVENSTYQ FPELESSNYE RTKGRVPTEH        60
     IDLRSPIICT KLSWSQDGTS LVAVFNDYGV RQYLLPEEEG TGLVPFKRFF RAQPAVDCCI       120
     HPEYSLFNDS DACNVMLASS RDLPIQLLSL SPHAREHRPL FSYSVVNAEN ERFETMFSLS       180
     FSHYSGFLAG TSRNKVVAYD LNYKSPIWSS DGYGKPLRGT SARRAIISCF DSPSDSESVL       240
     RYAGTYRCDI YGIDLRTKEL NFLANKQTLE LKENSAGVAE LLFSVNKHYL YVIKRNSQTI       300
     DVLDARSSFA KINELYLSFR IGSQKIIATL DLINGLLIGT HDGKILQWAS NMVEFGGLLP       360
     RTPEGPAKDS AVSKVFDTSY AGSRINILAS SPSNPHLIAG SFSPDKFEAD HTAKSGLFVV       420
     DL                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page