(data stored in SCRATCH zone)

EMBL: CU928166.PE299

CU928166.PE299       Location/Qualifiers
FT   CDS             584739..585329
FT                   /locus_tag="KLTH0B07238g"
FT                   /old_locus_tag="KLTH-ORF14954"
FT                   /product="KLTH0B07238p"
FT                   /note="highly similar to uniprot|Q12328 Saccharomyces
FT                   cerevisiae YDL217C TIM22 Mitochondrial inner membrane
FT                   protein involved in import of proteins of the ADP/ATP
FT                   carrier (AAC) family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07238g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21664"
FT                   /db_xref="GOA:C5DD03"
FT                   /db_xref="InterPro:IPR039175"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD03"
FT                   /protein_id="CAR21664.1"
FT                   /translation="MVYRGFGLEQVSPPPNKPFNEMTPEEQGEHGAQMMVNFMTSCPGK
FT                   TAISGVTGFALGGVFGLFMASMAYDTPLHTPTVPGESQLPSNVKHISDLPFKQQVKLQF
FT                   ADMGKRAYSSAKNFGYIGMIYSGVECVIESLRAKNDIYNGVTAGCLTGGGLAYKSGPSA
FT                   ALMGCAGFAAFSTAIDLYMRQENGTPPKNDFDE"
     MVYRGFGLEQ VSPPPNKPFN EMTPEEQGEH GAQMMVNFMT SCPGKTAISG VTGFALGGVF        60
     GLFMASMAYD TPLHTPTVPG ESQLPSNVKH ISDLPFKQQV KLQFADMGKR AYSSAKNFGY       120
     IGMIYSGVEC VIESLRAKND IYNGVTAGCL TGGGLAYKSG PSAALMGCAG FAAFSTAIDL       180
     YMRQENGTPP KNDFDE                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page