(data stored in ACNUC8465 zone)

EMBL: CU928166.PE300

CU928166.PE300       Location/Qualifiers
FT   CDS             complement(585375..586334)
FT                   /locus_tag="KLTH0B07260g"
FT                   /old_locus_tag="KLTH-ORF14953"
FT                   /product="KLTH0B07260p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07260g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21665"
FT                   /db_xref="GOA:C5DD04"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD04"
FT                   /protein_id="CAR21665.1"
FT                   /translation="MSPPGINQSNLPSREYRIASESRIARINELYNRSQRQQKHRDSII
FT                   SDNSTSVPYIQDEDDCQPLAYLAPNRVRRAPVAPPDSETIKPAPVKNPFRPKPTEERPF
FT                   SEDDVERELQFTPKLMSRRSIVSSRTPSHGTPLRREGPEDIVPDTPVQLPIWFSKQVVP
FT                   DFNNTNRAARRREAFKELKQKLGKPLPLGYLSDFQDEASRSTKKNVEERRKRMLSSKGR
FT                   DISWHDTRSLSDESSGIHSPHTSASSGDFIAGELSATSTDDGFHQNISEGLRTNSEKLD
FT                   QIMVLLETRKKAASKRECLAWIFCIIVLIALNLYLSNL"
     MSPPGINQSN LPSREYRIAS ESRIARINEL YNRSQRQQKH RDSIISDNST SVPYIQDEDD        60
     CQPLAYLAPN RVRRAPVAPP DSETIKPAPV KNPFRPKPTE ERPFSEDDVE RELQFTPKLM       120
     SRRSIVSSRT PSHGTPLRRE GPEDIVPDTP VQLPIWFSKQ VVPDFNNTNR AARRREAFKE       180
     LKQKLGKPLP LGYLSDFQDE ASRSTKKNVE ERRKRMLSSK GRDISWHDTR SLSDESSGIH       240
     SPHTSASSGD FIAGELSATS TDDGFHQNIS EGLRTNSEKL DQIMVLLETR KKAASKRECL       300
     AWIFCIIVLI ALNLYLSNL                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page