(data stored in ACNUC8465 zone)

EMBL: CU928166.PE305

CU928166.PE305       Location/Qualifiers
FT   CDS             complement(join(594459..594846,594905..594969))
FT                   /locus_tag="KLTH0B07370g"
FT                   /old_locus_tag="Klth0B.mRNA.at.2.p"
FT                   /product="KLTH0B07370p"
FT                   /note="highly similar to uniprot|Q07648 Saccharomyces
FT                   cerevisiae YDL219W DTD1 D-Tyr-tRNA(Tyr) deacylase functions
FT                   in protein translation may affect nonsense suppression via
FT                   alteration of the protein synthesis machinery ubiquitous
FT                   among eukaryotes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07370g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21670"
FT                   /db_xref="GOA:C5DD09"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD09"
FT                   /protein_id="CAR21670.1"
FT                   /translation="MRVVLQKVSKAAVTVDSEVVSAIKEGYMLLVGISVHDTIEDAEKI
FT                   SRKVLNLRIFEDENGAFWKKNVKEAGGQILSISQFTLQAVTKKGTKPDFHLAQKGPIAK
FT                   GLYDEFLGLLRKDMGDENVKDGVFGAMMSCELVNEGPVTIVLDTKE"
     MRVVLQKVSK AAVTVDSEVV SAIKEGYMLL VGISVHDTIE DAEKISRKVL NLRIFEDENG        60
     AFWKKNVKEA GGQILSISQF TLQAVTKKGT KPDFHLAQKG PIAKGLYDEF LGLLRKDMGD       120
     ENVKDGVFGA MMSCELVNEG PVTIVLDTKE                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page