(data stored in SCRATCH zone)

EMBL: CU928166.PE309

CU928166.PE309       Location/Qualifiers
FT   CDS             603685..604638
FT                   /locus_tag="KLTH0B07480g"
FT                   /old_locus_tag="KLTH-ORF14926"
FT                   /product="KLTH0B07480p"
FT                   /note="similar to uniprot|Q07651 Saccharomyces cerevisiae
FT                   YDL222C FMP45 The authentic non-tagged protein was
FT                   localized to the mitochondria cell cortex protein not
FT                   required for growth on nonfermentable carbon sources
FT                   required for viability in stationary phase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07480g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21674"
FT                   /db_xref="GOA:C5DD13"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD13"
FT                   /protein_id="CAR21674.1"
FT                   /translation="MDRKGFFNNSLSRLNSKSNLASNNQRSENMRFKQSVTFVFLVLLL
FT                   GAGLLSFLAILGGARNTGVLRNLYWLEANTSGFGNAPATTRWYNYEWCGYEGGSAQDCS
FT                   SRRPAQPFSPRDNFGASDAMPATFVNNRKTYYYLSRVAWAMLLVGLVFIVMAIVPLLAT
FT                   VFAASTWVASLSTVWLWSALFFVTLAACLYTGCYVKARNAFADNGRRAKLGSKNFAFIW
FT                   TSVALLLICALWSTITTAVFGINKVRSNRRDSHGYDSYEGDKATTMDTYGDSDHPASSP
FT                   TKFKYFKRIRRYQAPAAPPATMATNYDEENIPAAPR"
     MDRKGFFNNS LSRLNSKSNL ASNNQRSENM RFKQSVTFVF LVLLLGAGLL SFLAILGGAR        60
     NTGVLRNLYW LEANTSGFGN APATTRWYNY EWCGYEGGSA QDCSSRRPAQ PFSPRDNFGA       120
     SDAMPATFVN NRKTYYYLSR VAWAMLLVGL VFIVMAIVPL LATVFAASTW VASLSTVWLW       180
     SALFFVTLAA CLYTGCYVKA RNAFADNGRR AKLGSKNFAF IWTSVALLLI CALWSTITTA       240
     VFGINKVRSN RRDSHGYDSY EGDKATTMDT YGDSDHPASS PTKFKYFKRI RRYQAPAAPP       300
     ATMATNYDEE NIPAAPR                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page