(data stored in SCRATCH zone)

EMBL: CU928166.PE321

CU928166.PE321       Location/Qualifiers
FT   CDS             complement(628224..630065)
FT                   /locus_tag="KLTH0B07744g"
FT                   /old_locus_tag="KLTH-ORF14860"
FT                   /product="KLTH0B07744p"
FT                   /note="highly similar to uniprot|P40150 Saccharomyces
FT                   cerevisiae YNL209W SSB2 Ribosome-associated molecular
FT                   chaperone heat shock protein of HSP70 family proposed to be
FT                   involved in the folding of newly synthesized polypeptide
FT                   chains homolog of SSB1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07744g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21686"
FT                   /db_xref="GOA:C5DD25"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD25"
FT                   /protein_id="CAR21686.1"
FT                   /translation="MAEGVFAGAVGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVA
FT                   FTPEERLIGDAAKNQAALNPRNTVFDAKRLIGRRFDDESVQSDMKTWPFKVIDVNDAPM
FT                   IEVEYLGETKTFSPQEISSMVLTKMKETAEAKIGKKVEKAVITVPAYFNDAQRQATKDA
FT                   GAISGLNVLRIINEPTAAAIAYGLGAGKSDKERHVLIFDLGGGTFDVSLLHIAGGVYTV
FT                   KSTSGNTHLGGQDFDTNMLDHFKAEFKKKTGLDISNDARALRRLRTAAERAKRTLSSVT
FT                   QTTIEVDSLFEGEDFETSITRARFEDINAALFKSTLEPVEQVLKDAKIAKSQIDEVVLV
FT                   GGSTRIPKVQKLLSDFFEGKQLEKSINPDEAVAYGAAVQGAILTGQSTSEDTKDLLLLD
FT                   VAPLSLGVAMQGNVFAPVVPRNTTVPTIKRRTFTTVADHQTTVQFPVYQGERVNCSENT
FT                   LLGEFDLKGIPPLPAGEPVLEAIFEVDANGILKVTAVEKSTGKSANITISNAVGRLSSD
FT                   EIEKMVNQAEEFKAADEAFAKKHEARQRLESYVSSVEQTVTDPVLSSKMKRGAKSKIES
FT                   ALSDAMAALEIEDSSADDLRKAEVGLKRVVTKAMSTR"
     MAEGVFAGAV GIDLGTTYSC VATYESSVEI IANEQGNRVT PSFVAFTPEE RLIGDAAKNQ        60
     AALNPRNTVF DAKRLIGRRF DDESVQSDMK TWPFKVIDVN DAPMIEVEYL GETKTFSPQE       120
     ISSMVLTKMK ETAEAKIGKK VEKAVITVPA YFNDAQRQAT KDAGAISGLN VLRIINEPTA       180
     AAIAYGLGAG KSDKERHVLI FDLGGGTFDV SLLHIAGGVY TVKSTSGNTH LGGQDFDTNM       240
     LDHFKAEFKK KTGLDISNDA RALRRLRTAA ERAKRTLSSV TQTTIEVDSL FEGEDFETSI       300
     TRARFEDINA ALFKSTLEPV EQVLKDAKIA KSQIDEVVLV GGSTRIPKVQ KLLSDFFEGK       360
     QLEKSINPDE AVAYGAAVQG AILTGQSTSE DTKDLLLLDV APLSLGVAMQ GNVFAPVVPR       420
     NTTVPTIKRR TFTTVADHQT TVQFPVYQGE RVNCSENTLL GEFDLKGIPP LPAGEPVLEA       480
     IFEVDANGIL KVTAVEKSTG KSANITISNA VGRLSSDEIE KMVNQAEEFK AADEAFAKKH       540
     EARQRLESYV SSVEQTVTDP VLSSKMKRGA KSKIESALSD AMAALEIEDS SADDLRKAEV       600
     GLKRVVTKAM STR                                                          613
//

If you have problems or comments...

PBIL Back to PBIL home page