(data stored in ACNUC8465 zone)

EMBL: CU928166.PE322

CU928166.PE322       Location/Qualifiers
FT   CDS             complement(630469..631470)
FT                   /locus_tag="KLTH0B07766g"
FT                   /old_locus_tag="KLTH-ORF14852"
FT                   /product="KLTH0B07766p"
FT                   /note="some similarities with uniprot|P16523 Saccharomyces
FT                   cerevisiae YNL210W MER1 Protein with RNA- binding motifs
FT                   required for meiosis-specific mRNA splicing required for
FT                   chromosome pairing and meiotic recombination"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07766g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21687"
FT                   /db_xref="GOA:C5DD26"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD26"
FT                   /protein_id="CAR21687.1"
FT                   /translation="MDVCLEPPTVHQDQEAWQSYSLDQGEVGDPSTPRTAGSRAAAKGV
FT                   LKGPVSRDSNEKEASQGTVSRLEQVFRGARDSVSVRVACTVRADAPRARFLVSRLRVRS
FT                   FLEALALAGGGRERRLTGTLTITADSYHSATVECPLDVELLTSVVGDAPVCMLLPRELV
FT                   HVIRSGGLELRSQVRALSARAITLESIKSAPVFADLASLAAHSFYKCPHAPFCPIPARA
FT                   TPRCISATLVAPAACSRAPSEITTHTVRLNKPEITFLIGRQGARIEQLRLQSRAVIKIL
FT                   PIPARLSANQLANPACIEQCLSITGDIESVARAVCLVGALLETFRQAPRHVR"
     MDVCLEPPTV HQDQEAWQSY SLDQGEVGDP STPRTAGSRA AAKGVLKGPV SRDSNEKEAS        60
     QGTVSRLEQV FRGARDSVSV RVACTVRADA PRARFLVSRL RVRSFLEALA LAGGGRERRL       120
     TGTLTITADS YHSATVECPL DVELLTSVVG DAPVCMLLPR ELVHVIRSGG LELRSQVRAL       180
     SARAITLESI KSAPVFADLA SLAAHSFYKC PHAPFCPIPA RATPRCISAT LVAPAACSRA       240
     PSEITTHTVR LNKPEITFLI GRQGARIEQL RLQSRAVIKI LPIPARLSAN QLANPACIEQ       300
     CLSITGDIES VARAVCLVGA LLETFRQAPR HVR                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page