(data stored in ACNUC8465 zone)

EMBL: CU928166.PE323

CU928166.PE323       Location/Qualifiers
FT   CDS             complement(631704..632702)
FT                   /locus_tag="KLTH0B07788g"
FT                   /old_locus_tag="KLTH-ORF14847"
FT                   /product="KLTH0B07788p"
FT                   /note="similar to uniprot|P25044 Saccharomyces cerevisiae
FT                   YDL230W PTP1 Phosphotyrosine-specific protein phosphatase
FT                   that dephosphorylates a broad range of substrates in vivo
FT                   including Fpr3p localized to the cytoplasm and the
FT                   mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07788g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21688"
FT                   /db_xref="GOA:C5DD27"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR016277"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD27"
FT                   /protein_id="CAR21688.1"
FT                   /translation="MASETVPWYLKQSAQELVSKFRFIQHQEDLRLRDATLNPAKSRWS
FT                   LGSSVDESNDDRNRYVNIMPYERNRVKLRTQAGNDYINASYVKVQVPGQSVRPGHYIAT
FT                   QGPTQNSWPQFWQMCYQQCTGSDIVIAMVTPLVEGGRQKCFEYWPHDAAAPLKIPRTQS
FT                   SSCSASGPESSCTTFDVDLEVHFQCSERENDYTLSTLELAPADPAFPKKTVHHFYFDRW
FT                   RDMSKPDEIVPILKLSRHAHSLNSSENPMVVHCSAGVGRTGTFITLDHLFHDTLDFTAA
FT                   QPVQDYSHDLVEQIVLQLRTQRLKMVQMVDQFLFIYHAARYVFDLARTRDQ"
     MASETVPWYL KQSAQELVSK FRFIQHQEDL RLRDATLNPA KSRWSLGSSV DESNDDRNRY        60
     VNIMPYERNR VKLRTQAGND YINASYVKVQ VPGQSVRPGH YIATQGPTQN SWPQFWQMCY       120
     QQCTGSDIVI AMVTPLVEGG RQKCFEYWPH DAAAPLKIPR TQSSSCSASG PESSCTTFDV       180
     DLEVHFQCSE RENDYTLSTL ELAPADPAFP KKTVHHFYFD RWRDMSKPDE IVPILKLSRH       240
     AHSLNSSENP MVVHCSAGVG RTGTFITLDH LFHDTLDFTA AQPVQDYSHD LVEQIVLQLR       300
     TQRLKMVQMV DQFLFIYHAA RYVFDLARTR DQ                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page