(data stored in SCRATCH zone)

EMBL: CU928166.PE324

CU928166.PE324       Location/Qualifiers
FT   CDS             632854..636033
FT                   /locus_tag="KLTH0B07810g"
FT                   /old_locus_tag="KLTH-ORF14843"
FT                   /product="KLTH0B07810p"
FT                   /note="similar to uniprot|Q07660 Saccharomyces cerevisiae
FT                   YDL231C BRE4 Zinc finger protein containing five
FT                   transmembrane domains null mutant exhibits strongly
FT                   fragmented vacuoles and sensitivity to brefeldin A a drug
FT                   which is known to affect intracellular transport"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07810g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21689"
FT                   /db_xref="GOA:C5DD28"
FT                   /db_xref="InterPro:IPR018823"
FT                   /db_xref="InterPro:IPR023244"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD28"
FT                   /protein_id="CAR21689.1"
FT                   /translation="MVDSKVSKGSYKHKSFLSLKELGQSSKNKGPPSSRTSLSQLKLNL
FT                   LADGKHWEILEDYGLEELRDGFFDPIFTRHENVVPSEEDSDSAVSKTAGRLTVASWVAH
FT                   NLEGLKQSWQPMLKFWLAFFIAVCICLIHPSGSWLGHRFRYFMPVAVLIHHPARNIGVQ
FT                   LEITLWSITGAAFGMGWSALAWYISVATRPTANHQGGILFASMFLAVFLSTWLRSSKQR
FT                   LLYFSLSYGIAICFLHTVDLVNAKSMLDWKLYWDFGIPYLFGLLISMVVCAAVFPHSGQ
FT                   SEIISRFSTSINNIKQLLVTFLELDECGNTDRHHLLQKEIGTSIDFDVSEGMREFLNQL
FT                   TITRISEESLLSFRNSITIAAAPLRSMPTDHKLLTKLELQDFYEAYQDKHKEGQTVDKS
FT                   HGDTHMPVSGNATPLPKSNNFVGLGGHTNSELFTSMLRSTFSSSLLSLLVEMIALLETI
FT                   ESGLDNFANGKLFDNENLGIEEKLKSHISKLIRRIYNIDVCYKEFTKSNLFCKELLSDS
FT                   QAIDSFLFLRYLRQSAKNLIPVATCVVEMSANLRWRVELPHYPWRRALNRLPHRCSIDQ
FT                   GAKSLLHYFETKSDVDDLFEQLYNSYTSRHKVSAEGPEKGKIRATVRAIDHKDFSLHTT
FT                   SHPLRYKLWLLSTEITSYESRWALKIAIVMTFFALPAWLPQSNRWYQEYQCWWAPLSFL
FT                   LLSNRRHSGNWPSMGRRLASALLGIFWGWCSNQARHFGSPYVVATFAGLLCAVLSFNFF
FT                   ANNHTKSSFTGLLCFVVIALEPYSKRSSLNTAFIWKNTWVTGVALLCGILLSIPINWIL
FT                   WSFTARHELRISISSLLAHISQSYQSVTDRYLYRDADDAPTELTLKYSSIREVRLSQSL
FT                   IAVKRLLQKAREEPNYIFEFKADLYEQLLDACEYLLEKMVEARLSGQHFEVWDQDSNSE
FT                   ISRALLSLRRDSVASVIFIFYMLSNCFLSKNRIPMYLPNVIMSRKKLYDFISKFESNFA
FT                   SRSSTAVSNSESSDSEIKEHDTNPSSDDYEKSHWTQIHGMAFARAFTDIAEVVQKLANL
FT                   SREILGEEDCC"
     MVDSKVSKGS YKHKSFLSLK ELGQSSKNKG PPSSRTSLSQ LKLNLLADGK HWEILEDYGL        60
     EELRDGFFDP IFTRHENVVP SEEDSDSAVS KTAGRLTVAS WVAHNLEGLK QSWQPMLKFW       120
     LAFFIAVCIC LIHPSGSWLG HRFRYFMPVA VLIHHPARNI GVQLEITLWS ITGAAFGMGW       180
     SALAWYISVA TRPTANHQGG ILFASMFLAV FLSTWLRSSK QRLLYFSLSY GIAICFLHTV       240
     DLVNAKSMLD WKLYWDFGIP YLFGLLISMV VCAAVFPHSG QSEIISRFST SINNIKQLLV       300
     TFLELDECGN TDRHHLLQKE IGTSIDFDVS EGMREFLNQL TITRISEESL LSFRNSITIA       360
     AAPLRSMPTD HKLLTKLELQ DFYEAYQDKH KEGQTVDKSH GDTHMPVSGN ATPLPKSNNF       420
     VGLGGHTNSE LFTSMLRSTF SSSLLSLLVE MIALLETIES GLDNFANGKL FDNENLGIEE       480
     KLKSHISKLI RRIYNIDVCY KEFTKSNLFC KELLSDSQAI DSFLFLRYLR QSAKNLIPVA       540
     TCVVEMSANL RWRVELPHYP WRRALNRLPH RCSIDQGAKS LLHYFETKSD VDDLFEQLYN       600
     SYTSRHKVSA EGPEKGKIRA TVRAIDHKDF SLHTTSHPLR YKLWLLSTEI TSYESRWALK       660
     IAIVMTFFAL PAWLPQSNRW YQEYQCWWAP LSFLLLSNRR HSGNWPSMGR RLASALLGIF       720
     WGWCSNQARH FGSPYVVATF AGLLCAVLSF NFFANNHTKS SFTGLLCFVV IALEPYSKRS       780
     SLNTAFIWKN TWVTGVALLC GILLSIPINW ILWSFTARHE LRISISSLLA HISQSYQSVT       840
     DRYLYRDADD APTELTLKYS SIREVRLSQS LIAVKRLLQK AREEPNYIFE FKADLYEQLL       900
     DACEYLLEKM VEARLSGQHF EVWDQDSNSE ISRALLSLRR DSVASVIFIF YMLSNCFLSK       960
     NRIPMYLPNV IMSRKKLYDF ISKFESNFAS RSSTAVSNSE SSDSEIKEHD TNPSSDDYEK      1020
     SHWTQIHGMA FARAFTDIAE VVQKLANLSR EILGEEDCC                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page