(data stored in ACNUC8465 zone)

EMBL: CU928166.PE330

CU928166.PE330       Location/Qualifiers
FT   CDS             complement(643482..644171)
FT                   /locus_tag="KLTH0B07942g"
FT                   /old_locus_tag="KLTH-ORF14823"
FT                   /product="KLTH0B07942p"
FT                   /note="some similarities with uniprot|P40154 Saccharomyces
FT                   cerevisiae YNL215W IES2 Protein that associates with the
FT                   INO80 chromatin remodeling complex under low-salt
FT                   conditions"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07942g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21695"
FT                   /db_xref="GOA:C5DD34"
FT                   /db_xref="InterPro:IPR006880"
FT                   /db_xref="InterPro:IPR029523"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD34"
FT                   /protein_id="CAR21695.1"
FT                   /translation="MDSDLSSVGSEDEIYEETPEVAEEELIGSEPEDDEYQYTPDDYEE
FT                   DEETGQRSKSGSRSSRRAATNEPRASNRKRAPTDEFEEPGSSPAKRARRNGAIDLQNLD
FT                   DDDDDDDDTSSASQQKLNSRNKMISELMDNTSRRSSKLTDQELQLRRAENARKRKNLSE
FT                   KKLEEEKQDTINKLLRRRAGKSRAAMPAAQEQENDAANYVKPRRAYNAQGLVRTLRKKD
FT                   VDIYATY"
     MDSDLSSVGS EDEIYEETPE VAEEELIGSE PEDDEYQYTP DDYEEDEETG QRSKSGSRSS        60
     RRAATNEPRA SNRKRAPTDE FEEPGSSPAK RARRNGAIDL QNLDDDDDDD DDTSSASQQK       120
     LNSRNKMISE LMDNTSRRSS KLTDQELQLR RAENARKRKN LSEKKLEEEK QDTINKLLRR       180
     RAGKSRAAMP AAQEQENDAA NYVKPRRAYN AQGLVRTLRK KDVDIYATY                   229
//

If you have problems or comments...

PBIL Back to PBIL home page