(data stored in ACNUC8465 zone)

EMBL: CU928166.PE331

CU928166.PE331       Location/Qualifiers
FT   CDS             644343..646580
FT                   /locus_tag="KLTH0B07964g"
FT                   /old_locus_tag="KLTH-ORF14820"
FT                   /product="KLTH0B07964p"
FT                   /note="similar to uniprot|P48365 Saccharomyces cerevisiae
FT                   YDL234C GYP7 GTPase-activating protein for yeast Rab family
FT                   members including: Ypt7p (most effective) Ypt1p Ypt31p and
FT                   Ypt32p (in vitro) involved in vesicle mediated protein
FT                   trafficking"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07964g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21696"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD35"
FT                   /protein_id="CAR21696.1"
FT                   /translation="MSTELLFCKSKVYVHCSKKAEDNIAGFLLITRDAQQPSLEATLSW
FT                   IPERELSKLQLNELNRADGNTAKLAKIKKELILQAQYAAWAFCIKINSIYSIQFRAPSP
FT                   SGWWYGSIAINSKNSHDQGSIPILFFHDKECASTQAKQKALNKSFDPFSGTDVYWGASD
FT                   FRDAIMQLVDFKQTLVDPTVWLVNATLDDLRNFSPQDKKVEAEASTKDSTSPKFWDMLD
FT                   QARWNVMSKFADFTSKSTNKVVNIWSQHPLVQFVDKHNNNPYVKKIMTNPKVQEIQDDF
FT                   DSARIYLAKWALGVKEQAEKYQTANGLDDTYRRLLFNELGSDGEDVKLTDEELNIAMQR
FT                   SHPLTRQKWDSFFDSEGRLLMTVQEVKDYIFHGGVADMELRKDVWLFLLEVYPWDSSLE
FT                   ERQVLTQTLRESYRANYKSKWEYRQPHSDEDEESYWHDQVLRVEKDVKRNDRDLSLYKY
FT                   NTETGEAPASPQQDFDQGAEQVDSDVWTVKNPHLQSLRSILLSYNIYNNDLGYVQGMCD
FT                   LLSPIYYILQDEELSFWAFVNFMRRMERNFLRDQSGIRDQMMALTDLCQLMLPKMSAHL
FT                   AKCDSSNLFFCFRMLIVWFKREFEFEDVCSIWEVFLTDFYSSQFQLFFMLAVLQKNSAP
FT                   VMNNLDQFDQVLKFFNELKGTMDWSDLMIRSELLFVKFKKIMDTLERRAELAEYTLLTS
FT                   DGSVINESSAAASEQNALATQTSLITENLKQLMSKKIVIKREPARNKHSIR"
     MSTELLFCKS KVYVHCSKKA EDNIAGFLLI TRDAQQPSLE ATLSWIPERE LSKLQLNELN        60
     RADGNTAKLA KIKKELILQA QYAAWAFCIK INSIYSIQFR APSPSGWWYG SIAINSKNSH       120
     DQGSIPILFF HDKECASTQA KQKALNKSFD PFSGTDVYWG ASDFRDAIMQ LVDFKQTLVD       180
     PTVWLVNATL DDLRNFSPQD KKVEAEASTK DSTSPKFWDM LDQARWNVMS KFADFTSKST       240
     NKVVNIWSQH PLVQFVDKHN NNPYVKKIMT NPKVQEIQDD FDSARIYLAK WALGVKEQAE       300
     KYQTANGLDD TYRRLLFNEL GSDGEDVKLT DEELNIAMQR SHPLTRQKWD SFFDSEGRLL       360
     MTVQEVKDYI FHGGVADMEL RKDVWLFLLE VYPWDSSLEE RQVLTQTLRE SYRANYKSKW       420
     EYRQPHSDED EESYWHDQVL RVEKDVKRND RDLSLYKYNT ETGEAPASPQ QDFDQGAEQV       480
     DSDVWTVKNP HLQSLRSILL SYNIYNNDLG YVQGMCDLLS PIYYILQDEE LSFWAFVNFM       540
     RRMERNFLRD QSGIRDQMMA LTDLCQLMLP KMSAHLAKCD SSNLFFCFRM LIVWFKREFE       600
     FEDVCSIWEV FLTDFYSSQF QLFFMLAVLQ KNSAPVMNNL DQFDQVLKFF NELKGTMDWS       660
     DLMIRSELLF VKFKKIMDTL ERRAELAEYT LLTSDGSVIN ESSAAASEQN ALATQTSLIT       720
     ENLKQLMSKK IVIKREPARN KHSIR                                             745
//

If you have problems or comments...

PBIL Back to PBIL home page