(data stored in SCRATCH zone)

EMBL: CU928166.PE332

CU928166.PE332       Location/Qualifiers
FT   CDS             complement(646727..648892)
FT                   /locus_tag="KLTH0B07986g"
FT                   /old_locus_tag="KLTH-ORF14818"
FT                   /product="KLTH0B07986p"
FT                   /note="similar to uniprot|P11938 Saccharomyces cerevisiae
FT                   YNL216W RAP1 DNA-binding protein involved in either
FT                   activation or repression of transcription depending on
FT                   binding site context also binds telomere sequences and
FT                   plays a role in telomeric position effect (silencing) and
FT                   telomere structure"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07986g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21697"
FT                   /db_xref="GOA:C5DD36"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015280"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="InterPro:IPR021661"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR038104"
FT                   /db_xref="InterPro:IPR039595"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD36"
FT                   /protein_id="CAR21697.1"
FT                   /translation="MSQQDDFETPSTNAFEDALEHQSQHYEDGKPDTRSDKDASGKDEG
FT                   AGSGGDDQQDIFQDLGFFIAHDESRQELEQLVSGHGGTVLSELPSGKSNKEFVVSTINA
FT                   SDLPTVTPTYIKTCCENNVLMKVQPFLVPYNEFRAVIDTQLQNESGEKPTAPADDASET
FT                   AEQPVESPSTKPGEDKRPDADTPQPSETNGGPMASVTAESNAGSEDQGAGARRESVDSA
FT                   KNSISGDESDVVKTPVAPSPPSARQPAASHNKSSFTEEEDEFILDVVRKNPTRRTTHTL
FT                   FDEISHYVPKHTGNSIRHRYRVYLAKRLNFVYQVDSTGKLVRDDNGDLIKTTVLPKSLK
FT                   NKFTASEDYALSVEVKKQFYRDIYQMDPDTGESLIKDINAPDGNLKGSFGAGSDERQNP
FT                   GPSFKDFRVGERRGPVPREFFKKYADENPNHTENAWRDRFRKFLLTFGIDRYIEYYENE
FT                   IAQSRVPQAMKNMTNRPKRPGVPTPGNYNSFAKKVKTLSQQQQQQAAAIIAANGGAIDP
FT                   AALAFAIPEGDFLDEETLNFISGLRRDLSKIESAGGAAFAYPQEIAESIRNDFTNEEAQ
FT                   FDEIDPDKIPFPPALVTNELFMPQFFHFGSTREFLDKINEVISRDYEPSQAEKLVQDLC
FT                   DDVGVRKTFSTSILTALSGDLMVFPRYFLCMFHFGSNPPMNIPGIWTREDDEMLRSGEE
FT                   SNIKKLTQKHGAGRIEMRKRFIASDLV"
     MSQQDDFETP STNAFEDALE HQSQHYEDGK PDTRSDKDAS GKDEGAGSGG DDQQDIFQDL        60
     GFFIAHDESR QELEQLVSGH GGTVLSELPS GKSNKEFVVS TINASDLPTV TPTYIKTCCE       120
     NNVLMKVQPF LVPYNEFRAV IDTQLQNESG EKPTAPADDA SETAEQPVES PSTKPGEDKR       180
     PDADTPQPSE TNGGPMASVT AESNAGSEDQ GAGARRESVD SAKNSISGDE SDVVKTPVAP       240
     SPPSARQPAA SHNKSSFTEE EDEFILDVVR KNPTRRTTHT LFDEISHYVP KHTGNSIRHR       300
     YRVYLAKRLN FVYQVDSTGK LVRDDNGDLI KTTVLPKSLK NKFTASEDYA LSVEVKKQFY       360
     RDIYQMDPDT GESLIKDINA PDGNLKGSFG AGSDERQNPG PSFKDFRVGE RRGPVPREFF       420
     KKYADENPNH TENAWRDRFR KFLLTFGIDR YIEYYENEIA QSRVPQAMKN MTNRPKRPGV       480
     PTPGNYNSFA KKVKTLSQQQ QQQAAAIIAA NGGAIDPAAL AFAIPEGDFL DEETLNFISG       540
     LRRDLSKIES AGGAAFAYPQ EIAESIRNDF TNEEAQFDEI DPDKIPFPPA LVTNELFMPQ       600
     FFHFGSTREF LDKINEVISR DYEPSQAEKL VQDLCDDVGV RKTFSTSILT ALSGDLMVFP       660
     RYFLCMFHFG SNPPMNIPGI WTREDDEMLR SGEESNIKKL TQKHGAGRIE MRKRFIASDL       720
     V                                                                       721
//

If you have problems or comments...

PBIL Back to PBIL home page