(data stored in ACNUC8465 zone)

EMBL: CU928166.PE334

CU928166.PE334       Location/Qualifiers
FT   CDS             652379..652795
FT                   /locus_tag="KLTH0B08030g"
FT                   /old_locus_tag="KLTH-ORF14803"
FT                   /product="KLTH0B08030p"
FT                   /note="similar to uniprot|Q07688 Saccharomyces cerevisiae
FT                   YDL235C YPD1 Phosphorelay intermediate protein
FT                   phosphorylated by the plasma membrane sensor Sln1p in
FT                   response to osmotic stress and then in turn phosphorylates
FT                   the response regulators Ssk1p in the cytosol and Skn7p in
FT                   the nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08030g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21699"
FT                   /db_xref="GOA:C5DD38"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD38"
FT                   /protein_id="CAR21699.1"
FT                   /translation="MNTVPIPAGVINWNTLNEIVSMDEDSPDFSKNLIIQYLEQANTTF
FT                   DQIEQELQGNCDLEQLASLGHFLRGSSAALGLQRISWACERIQNLGRKREGGVEGQQLP
FT                   DSHYAQLITNALQCARNEFKAAKAELSAFYKSEL"
     MNTVPIPAGV INWNTLNEIV SMDEDSPDFS KNLIIQYLEQ ANTTFDQIEQ ELQGNCDLEQ        60
     LASLGHFLRG SSAALGLQRI SWACERIQNL GRKREGGVEG QQLPDSHYAQ LITNALQCAR       120
     NEFKAAKAEL SAFYKSEL                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page