(data stored in ACNUC8465 zone)

EMBL: CU928166.PE34

CU928166.PE34        Location/Qualifiers
FT   CDS             complement(89368..89970)
FT                   /locus_tag="KLTH0B01056g"
FT                   /old_locus_tag="KLTH-ORF15872"
FT                   /product="KLTH0B01056p"
FT                   /note="similar to uniprot|P47123 Saccharomyces cerevisiae
FT                   YJR074W MOG1 Conserved nuclear protein that interacts with
FT                   GTP-Gsp1p which is a Ran homolog of the Ras GTPase family
FT                   and stimulates nucleotide release involved in nuclear
FT                   protein import nucleotide release is inhibited by Yrb1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01056g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21399"
FT                   /db_xref="InterPro:IPR007681"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC88"
FT                   /protein_id="CAR21399.1"
FT                   /translation="MFQKQALYGGAISTVIPKGFLDASILREVPDTQEVFVNSREEKEI
FT                   AVFKDGLGLDESVIVDLLQRVEEDDSCRALDVHLQEIAGLNGSHEWNLVECEQSAPEVG
FT                   QVPHLTCIAVEAAYKWGKSDMRETLVLCVALLRFDDVQTDVVLSVNIPVTSEPELQLLN
FT                   AWLSKTSSTIPLRIAAAYHLVKQMASEFRILDKGLFV"
     MFQKQALYGG AISTVIPKGF LDASILREVP DTQEVFVNSR EEKEIAVFKD GLGLDESVIV        60
     DLLQRVEEDD SCRALDVHLQ EIAGLNGSHE WNLVECEQSA PEVGQVPHLT CIAVEAAYKW       120
     GKSDMRETLV LCVALLRFDD VQTDVVLSVN IPVTSEPELQ LLNAWLSKTS STIPLRIAAA       180
     YHLVKQMASE FRILDKGLFV                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page