(data stored in ACNUC8465 zone)

EMBL: CU928166.PE340

CU928166.PE340       Location/Qualifiers
FT   CDS             661997..664531
FT                   /locus_tag="KLTH0B08162g"
FT                   /old_locus_tag="KLTH-ORF14778"
FT                   /product="KLTH0B08162p"
FT                   /note="similar to uniprot|P41812 Saccharomyces cerevisiae
FT                   YNL221C POP1 Subunit of both RNase MRP which cleaves pre-
FT                   rRNA and nuclear RNase P which cleaves tRNA precursors to
FT                   generate mature 5' ends binds to the RPR1 RNA subunit in
FT                   Rnase P"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08162g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21705"
FT                   /db_xref="GOA:C5DD44"
FT                   /db_xref="InterPro:IPR009723"
FT                   /db_xref="InterPro:IPR012590"
FT                   /db_xref="InterPro:IPR039182"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD44"
FT                   /protein_id="CAR21705.1"
FT                   /translation="MSGKKPRSQNQLYRRRKVQDARNIRTEALKSGAQASQELSESGGM
FT                   MRVPEFMASREFEVKQLQVAMHKSKSASSTRVFQSLPRKLRRRTASHNVKRIPKRLRNR
FT                   ALREMQKSDQAVTRGTEKPSRQRRSGLTAKQLYKARMTVKLLRLAARSKSMKLALPAQV
FT                   TGSQTKLRQRIRALQKTLRAEAKPGTAQLRNNQMGSYDCTGIGKLAPRPVGRIKYMKRQ
FT                   RVFTWLPTHVWNAKRSHMLKRWGYQMPWSPTQKCFKLTHRIGGNTAASDGALCCDSSYM
FT                   GTMIVASADTEALRLLAHQLTNKRATLPKYRVSGHWFEGLIYDENAEAVGPGEILWISS
FT                   NKLLLRLHPAIYSRVFEQISLANSEKKFVIQDCRFSIGSITLSGGKSLNALSQVLRSTT
FT                   ASKSYNQFKTVAYVTDTNVLPQRTVFAFEAIDPRHLSNPRALPKANINANDVLKLQAEY
FT                   PREEIAEVLEKLCNPDKREMSYKNQQTLKQLAYRRRMLLESTARTNAIPHDSKEDPFIP
FT                   IAIFKRPKQESWVVLLPWFWLLPLWYQLNRVSRVYHMGLRQLQQLSFEQRRLYFPDDYP
FT                   FTQAGYDENSTFKRLSQEALWKRKPAGKRVNFDKISGIHTENPVRFPGEIGDPFSCDWR
FT                   LLQVLRNGIDFLRTRDQGPIRMYDPKRTSQFDELNMRKLMYVNDIIDLYSDVQDKKLTP
FT                   SALPISIFTKSVKGANSGCPQYGNSPRMQIVTTPLQVAAVSCVLQEQGHPKDFARVYAI
FT                   PAQDMDYWLSIVNIKARSNGKRDHDTAQPTPGVQDLIGFVTSGTFHLGDGRGACTAFIA
FT                   AQEACKSPNEYVLIRNVGTNVYRVAKWEQIAL"
     MSGKKPRSQN QLYRRRKVQD ARNIRTEALK SGAQASQELS ESGGMMRVPE FMASREFEVK        60
     QLQVAMHKSK SASSTRVFQS LPRKLRRRTA SHNVKRIPKR LRNRALREMQ KSDQAVTRGT       120
     EKPSRQRRSG LTAKQLYKAR MTVKLLRLAA RSKSMKLALP AQVTGSQTKL RQRIRALQKT       180
     LRAEAKPGTA QLRNNQMGSY DCTGIGKLAP RPVGRIKYMK RQRVFTWLPT HVWNAKRSHM       240
     LKRWGYQMPW SPTQKCFKLT HRIGGNTAAS DGALCCDSSY MGTMIVASAD TEALRLLAHQ       300
     LTNKRATLPK YRVSGHWFEG LIYDENAEAV GPGEILWISS NKLLLRLHPA IYSRVFEQIS       360
     LANSEKKFVI QDCRFSIGSI TLSGGKSLNA LSQVLRSTTA SKSYNQFKTV AYVTDTNVLP       420
     QRTVFAFEAI DPRHLSNPRA LPKANINAND VLKLQAEYPR EEIAEVLEKL CNPDKREMSY       480
     KNQQTLKQLA YRRRMLLEST ARTNAIPHDS KEDPFIPIAI FKRPKQESWV VLLPWFWLLP       540
     LWYQLNRVSR VYHMGLRQLQ QLSFEQRRLY FPDDYPFTQA GYDENSTFKR LSQEALWKRK       600
     PAGKRVNFDK ISGIHTENPV RFPGEIGDPF SCDWRLLQVL RNGIDFLRTR DQGPIRMYDP       660
     KRTSQFDELN MRKLMYVNDI IDLYSDVQDK KLTPSALPIS IFTKSVKGAN SGCPQYGNSP       720
     RMQIVTTPLQ VAAVSCVLQE QGHPKDFARV YAIPAQDMDY WLSIVNIKAR SNGKRDHDTA       780
     QPTPGVQDLI GFVTSGTFHL GDGRGACTAF IAAQEACKSP NEYVLIRNVG TNVYRVAKWE       840
     QIAL                                                                    844
//

If you have problems or comments...

PBIL Back to PBIL home page