(data stored in ACNUC8465 zone)

EMBL: CU928166.PE342

CU928166.PE342       Location/Qualifiers
FT   CDS             667368..668792
FT                   /locus_tag="KLTH0B08228g"
FT                   /old_locus_tag="KLTH-ORF14772"
FT                   /product="KLTH0B08228p"
FT                   /note="similar to uniprot|Q07729 Saccharomyces cerevisiae
FT                   YDL238C GUD1 Guanine deaminase a catabolic enzyme of the
FT                   guanine salvage pathway producing xanthine and ammonia from
FT                   guanine activity is low in exponentially- growing cultures
FT                   but expression is increased in post- diauxic and
FT                   stationary-phase cultures"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08228g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21707"
FT                   /db_xref="GOA:C5DD46"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD46"
FT                   /protein_id="CAR21707.1"
FT                   /translation="MILKLTVYHGNFVDTPSLGDVRIRPQTTIGVGTDGKILFIKEKSQ
FT                   DPLRDALDFDQTLQPSEVAVVKISGSQDGSFFFPGFVDTHVHASQYPNAGIFGSSTLLD
FT                   WLQTYTFPLEASLKDADTARAVYNRVLDRTLANGTTTASYYTTIDAASSNLMARICAEK
FT                   GQRAFIGKVCMDQNSPDYYVELFKECKHSTRQVVDYIKKELKDEKIQPVLTPRFAPSCS
FT                   RELMSWLGQLAHEEDLNVQTHLSENLAELELVAELFPECENYSQVYDNHHLLTKKTLLA
FT                   HCVHLSDKEIELLKLRGCGVSHCPISNSSLASGECRVRLLLDNGINVGLGTDLSGGYSS
FT                   SILAVARQALLVSRHLAMKETDAKKQEHVNLSVEDVLFLASLGGAQALSLGSVVGSFEV
FT                   NKQFDAQLINLDPVSSNVDVFEWQRTSWNDSPKEGENQKLARNLLAKWLFTGDDRNTAR
FT                   VWVAGRLVHSYPASAT"
     MILKLTVYHG NFVDTPSLGD VRIRPQTTIG VGTDGKILFI KEKSQDPLRD ALDFDQTLQP        60
     SEVAVVKISG SQDGSFFFPG FVDTHVHASQ YPNAGIFGSS TLLDWLQTYT FPLEASLKDA       120
     DTARAVYNRV LDRTLANGTT TASYYTTIDA ASSNLMARIC AEKGQRAFIG KVCMDQNSPD       180
     YYVELFKECK HSTRQVVDYI KKELKDEKIQ PVLTPRFAPS CSRELMSWLG QLAHEEDLNV       240
     QTHLSENLAE LELVAELFPE CENYSQVYDN HHLLTKKTLL AHCVHLSDKE IELLKLRGCG       300
     VSHCPISNSS LASGECRVRL LLDNGINVGL GTDLSGGYSS SILAVARQAL LVSRHLAMKE       360
     TDAKKQEHVN LSVEDVLFLA SLGGAQALSL GSVVGSFEVN KQFDAQLINL DPVSSNVDVF       420
     EWQRTSWNDS PKEGENQKLA RNLLAKWLFT GDDRNTARVW VAGRLVHSYP ASAT             474
//

If you have problems or comments...

PBIL Back to PBIL home page