(data stored in ACNUC8465 zone)

EMBL: CU928166.PE343

CU928166.PE343       Location/Qualifiers
FT   CDS             complement(668789..669409)
FT                   /locus_tag="KLTH0B08250g"
FT                   /old_locus_tag="KLTH-ORF14770"
FT                   /product="KLTH0B08250p"
FT                   /note="highly similar to uniprot|P53538 Saccharomyces
FT                   cerevisiae YNL222W SSU72 Transcription/RNA-processing
FT                   factor that associates with TFIIB and
FT                   cleavage/polyadenylation factor Pta1p exhibits intrinsic
FT                   phosphatase activity affects start site selection in vivo
FT                   Nuclear zinc-finger motif containing protein."
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08250g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21708"
FT                   /db_xref="GOA:C5DD47"
FT                   /db_xref="InterPro:IPR006811"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD47"
FT                   /protein_id="CAR21708.1"
FT                   /translation="MSNEPTKSLKFCTVCASNNNRSMESHRVLREAGYDVSSYGTGSAV
FT                   RLPGLSEDKPNVYAFGTPYNDIYNDLRSQSVERYRSNGLLEMLDRNRKLKKAPEKWQEG
FT                   FKVFDFVFTCEERCFDAVCEDLMNRGGQLNKIVHVININIRDDNENAKIGSKAILKLAD
FT                   MLSQETVRCEKTGEPLEDCIISLLAQWQEMYPQLPLLYSPAYY"
     MSNEPTKSLK FCTVCASNNN RSMESHRVLR EAGYDVSSYG TGSAVRLPGL SEDKPNVYAF        60
     GTPYNDIYND LRSQSVERYR SNGLLEMLDR NRKLKKAPEK WQEGFKVFDF VFTCEERCFD       120
     AVCEDLMNRG GQLNKIVHVI NINIRDDNEN AKIGSKAILK LADMLSQETV RCEKTGEPLE       180
     DCIISLLAQW QEMYPQLPLL YSPAYY                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page