(data stored in SCRATCH zone)

EMBL: CU928166.PE346

CU928166.PE346       Location/Qualifiers
FT   CDS             673602..676454
FT                   /locus_tag="KLTH0B08316g"
FT                   /old_locus_tag="KLTH-ORF14763"
FT                   /product="KLTH0B08316p"
FT                   /note="some similarities with uniprot|P25386 Saccharomyces
FT                   cerevisiae YDL058W USO1 involved intracellular protein
FT                   transport coiled-coil protein necessary for protein
FT                   transport from ER to Golgi Integrin analogue gene"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08316g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21711"
FT                   /db_xref="InterPro:IPR021750"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD50"
FT                   /protein_id="CAR21711.1"
FT                   /translation="MLGLGSGHIYSMANQSTVSNMSKDEKYDYEDEVSDENEDSGISLT
FT                   KVRAEQGFSLRSFIDQINAKTKALAIARELDAQRGVTHQDATMSAGSIDSATSASTETQ
FT                   RTQEISSHPTATVRRIPSGARASTAEPNLGSSTPMKEVSRSDNTHNQTINDLLVQSTPI
FT                   NSSKSAPTSRNTQPRDLLKEKFMESHKAQNERSATGNADELQFENVRLREELEFYKKAH
FT                   DSQEENIQVLQETLQKQDQTAQALREKLQELQDQVEESAQALKVAQDDRRSEFEGHQRV
FT                   AEELAKCKGQIRLKEDEIVTVTENADKACQDLRTDNAGLHKKAIEIQSALTESELYVQQ
FT                   LKSKVDLMKKHNDDLSQTVHDKIEELNECNTRIDELYKENIAQENSLRSRVKEYDSELS
FT                   SLRNRNEELQKKLELQDHEFISKSSSYEARISSLKSANEDLEKGIELERTKSSKEAHVL
FT                   GDTVVTLRQQLADAEKENEKILVRFNMLEKQHLEAENLRDGLEETNQELKSVVTRLEKI
FT                   SSDQLQTIGRLEEEVERKSKKEANSLSSVRKHSKQLEEKVRHLQDVIVAKNSELEMQKQ
FT                   ELNQFESYLKSVSLFQIQAGDLIVEQYRLNKYATQMDAAFKERNPDILGFFTQDQLQTT
FT                   ENSAVRLEALDNELHKLEESIKDEWTVKVQQLEEKLKNQELKESTIAKQLAGNNIRIEE
FT                   LNSMVGTLSAEKRDLLHEKEKSMEMQQRLNDQVNSLKGELVDGEHKAFISLSNRIESLG
FT                   EERLDLQQNLQALESKIKSTETLLNEANALLNQERSEHATSQDEAAQLRKDLARLKGKA
FT                   SRKITFQMASQSRPHLSRKTYDSLMVDAVNDMDMVELQNIIKNIILLLEIPLAKITKKM
FT                   PLVGIYLRYEKNICLHFANKIHYLMFRETIDIKRYTNVAYGQYLDHHDICHLDHPLESC
FT                   LDNLYKEVSARLSLSPLTNG"
     MLGLGSGHIY SMANQSTVSN MSKDEKYDYE DEVSDENEDS GISLTKVRAE QGFSLRSFID        60
     QINAKTKALA IARELDAQRG VTHQDATMSA GSIDSATSAS TETQRTQEIS SHPTATVRRI       120
     PSGARASTAE PNLGSSTPMK EVSRSDNTHN QTINDLLVQS TPINSSKSAP TSRNTQPRDL       180
     LKEKFMESHK AQNERSATGN ADELQFENVR LREELEFYKK AHDSQEENIQ VLQETLQKQD       240
     QTAQALREKL QELQDQVEES AQALKVAQDD RRSEFEGHQR VAEELAKCKG QIRLKEDEIV       300
     TVTENADKAC QDLRTDNAGL HKKAIEIQSA LTESELYVQQ LKSKVDLMKK HNDDLSQTVH       360
     DKIEELNECN TRIDELYKEN IAQENSLRSR VKEYDSELSS LRNRNEELQK KLELQDHEFI       420
     SKSSSYEARI SSLKSANEDL EKGIELERTK SSKEAHVLGD TVVTLRQQLA DAEKENEKIL       480
     VRFNMLEKQH LEAENLRDGL EETNQELKSV VTRLEKISSD QLQTIGRLEE EVERKSKKEA       540
     NSLSSVRKHS KQLEEKVRHL QDVIVAKNSE LEMQKQELNQ FESYLKSVSL FQIQAGDLIV       600
     EQYRLNKYAT QMDAAFKERN PDILGFFTQD QLQTTENSAV RLEALDNELH KLEESIKDEW       660
     TVKVQQLEEK LKNQELKEST IAKQLAGNNI RIEELNSMVG TLSAEKRDLL HEKEKSMEMQ       720
     QRLNDQVNSL KGELVDGEHK AFISLSNRIE SLGEERLDLQ QNLQALESKI KSTETLLNEA       780
     NALLNQERSE HATSQDEAAQ LRKDLARLKG KASRKITFQM ASQSRPHLSR KTYDSLMVDA       840
     VNDMDMVELQ NIIKNIILLL EIPLAKITKK MPLVGIYLRY EKNICLHFAN KIHYLMFRET       900
     IDIKRYTNVA YGQYLDHHDI CHLDHPLESC LDNLYKEVSA RLSLSPLTNG                  950
//

If you have problems or comments...

PBIL Back to PBIL home page