(data stored in ACNUC8465 zone)

EMBL: CU928166.PE349

CU928166.PE349       Location/Qualifiers
FT   CDS             680750..681883
FT                   /locus_tag="KLTH0B08382g"
FT                   /old_locus_tag="KLTH-ORF14752"
FT                   /product="KLTH0B08382p"
FT                   /note="some similarities with uniprot|P53861 Saccharomyces
FT                   cerevisiae YNL230C ELA1 Elongin A F-box protein that forms
FT                   a heterodimer with Elc1p and participates in transcription
FT                   elongation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08382g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21714"
FT                   /db_xref="GOA:C5DD53"
FT                   /db_xref="InterPro:IPR010684"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD53"
FT                   /protein_id="CAR21714.1"
FT                   /translation="MPISENEEEFTMEHKQTKIKSLSSLCEISLMRNHLMLQNVANVPY
FT                   RLVRNVLLKLKMEHLCKLEESNVLLIFEDEEAWVELLKKDFPMHVHDTYHRKRDEIVAF
FT                   YADFVEKHDPPKLRDEELMRGFLRFAVRKEPATHKYKVPSRMLYFKYQEDMLRKQELST
FT                   QRLRMRMQEMQQEKEKKQIVPLDDPVYCERRTKAAARAGAGERSGLFAKSYKEHQKRQL
FT                   HFKSGGYDAKSRPVKRLAFGGQVGRPAPSPAAPAPCAAPAPPVAAPAPLPATMQDTSQP
FT                   KRSTPAVAPSARRKPTPEQNLFLKRRRPLPKPKTPPTPRAEPSVKRKPTVVKVNSTKIH
FT                   RKNTKTSIFAAPSPQQQVLSQHSNTSSAYIFDQPRQG"
     MPISENEEEF TMEHKQTKIK SLSSLCEISL MRNHLMLQNV ANVPYRLVRN VLLKLKMEHL        60
     CKLEESNVLL IFEDEEAWVE LLKKDFPMHV HDTYHRKRDE IVAFYADFVE KHDPPKLRDE       120
     ELMRGFLRFA VRKEPATHKY KVPSRMLYFK YQEDMLRKQE LSTQRLRMRM QEMQQEKEKK       180
     QIVPLDDPVY CERRTKAAAR AGAGERSGLF AKSYKEHQKR QLHFKSGGYD AKSRPVKRLA       240
     FGGQVGRPAP SPAAPAPCAA PAPPVAAPAP LPATMQDTSQ PKRSTPAVAP SARRKPTPEQ       300
     NLFLKRRRPL PKPKTPPTPR AEPSVKRKPT VVKVNSTKIH RKNTKTSIFA APSPQQQVLS       360
     QHSNTSSAYI FDQPRQG                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page