(data stored in ACNUC8465 zone)

EMBL: CU928166.PE351

CU928166.PE351       Location/Qualifiers
FT   CDS             complement(683397..684242)
FT                   /locus_tag="KLTH0B08426g"
FT                   /old_locus_tag="KLTH-ORF14746"
FT                   /product="KLTH0B08426p"
FT                   /note="similar to uniprot|P53859 Saccharomyces cerevisiae
FT                   YNL232W CSL4 Subunit of the exosome which is an essential
FT                   complex present in both nucleus and cytoplasm that mediates
FT                   RNA processing and degradation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08426g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21716"
FT                   /db_xref="GOA:C5DD55"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019495"
FT                   /db_xref="InterPro:IPR039771"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD55"
FT                   /protein_id="CAR21716.1"
FT                   /translation="MVYYAQSTHSAYPGQLICPVYELEKGTDSQQVIRYIAGAGVAEQD
FT                   YELNGQKIIALAATVVGEVKFDEELKEMVPSGEVAESNENEEEETVSTEEERHFIVSVT
FT                   DKRQDGQAVTADFANNLPREGDIVLARVTRISQQRANVEILAVENKTTPVDSGVGSNGA
FT                   GIVAAGGGSGGATFSVSQASSDLGETFRGLISSRDVRATDRDKVKIIDSFRPGDIVRAQ
FT                   VISLGDGSNYHLSTARNDLGVVFAKACNGAGGMMYAIDWKTMVAPSTGFTEARKCAKPF
FT                   "
     MVYYAQSTHS AYPGQLICPV YELEKGTDSQ QVIRYIAGAG VAEQDYELNG QKIIALAATV        60
     VGEVKFDEEL KEMVPSGEVA ESNENEEEET VSTEEERHFI VSVTDKRQDG QAVTADFANN       120
     LPREGDIVLA RVTRISQQRA NVEILAVENK TTPVDSGVGS NGAGIVAAGG GSGGATFSVS       180
     QASSDLGETF RGLISSRDVR ATDRDKVKII DSFRPGDIVR AQVISLGDGS NYHLSTARND       240
     LGVVFAKACN GAGGMMYAID WKTMVAPSTG FTEARKCAKP F                           281
//

If you have problems or comments...

PBIL Back to PBIL home page