(data stored in ACNUC8465 zone)

EMBL: CU928166.PE352

CU928166.PE352       Location/Qualifiers
FT   CDS             complement(684529..687123)
FT                   /locus_tag="KLTH0B08448g"
FT                   /old_locus_tag="KLTH-ORF14744"
FT                   /product="KLTH0B08448p"
FT                   /note="weakly similar to uniprot|P53858 Saccharomyces
FT                   cerevisiae YNL233W BNI4 Targeting subunit for Glc7p protein
FT                   phosphatase localized to the bud neck required for
FT                   localization of chitin synthase III to the bud neck via
FT                   interaction with the chitin synthase III regulatory subunit
FT                   Skt5p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08448g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21717"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD56"
FT                   /protein_id="CAR21717.1"
FT                   /translation="MNQSLEEANNDGESYLNDTFYSSTSTDNLEHARTFRNSVLMQDMS
FT                   GEKPYNPEQEQIPSDPSDTQGKQYLKSNTNDANDRETETKTLTVTASPSLSALAGILNE
FT                   KAIQAEKKMRSSMILDNSIQESIPEEEHSVHNSPVLIDIDGTSDGSYRLKFPPQMAHLQ
FT                   NEIEQPDFLTTPRLDPPTPRVEPADSDLPNGGQQEKPQEQVSNVSSEREIETQNSNSPK
FT                   ATAERADNSRPLPRKQASLRSFSGMSVGSFASNEQPLKESSSGKKRKSIFSFLKKKPRK
FT                   NSSLLSQDNSSSATLPTSATFSVSKSYHENDLPASTRLTKNSPSNGSIFSTFRKNKASK
FT                   KEAAAAADRTLHVPKQRATSGDSNSSNTGGASQQKRGVQTRKPTPLDFEHVSQKAPSTQ
FT                   HNSPILTEPSTELQNTPQLVVKSPVPSENKVPDDVGESLLKADSGGVLFPKSLSAHEVE
FT                   SIVSLERSRSVKSAKRNSLNSHRVSLTDNMSAKINNDGMFITEPSAPKLSTPDLTKSPT
FT                   SSILRNGTFDTLESSTQRGSYAEPNNLGISSAGLRAQDRDFSFTSIEQKLNDITLDSES
FT                   EDELAVNTKKASTSAGENFDTELMSDIMEFANIIDFGKDLDLNLDLSQEDINYKSLNPS
FT                   DVKQSEKLPRDEMSADSFNFNSVAQVPLSSSGDRQSFSQHSYRSSIERNDTTNTDRTSF
FT                   RRHSTLLSPPLNEDTRTEQMRNILSADDDDDEFEGEDFNELEEKLESQTIGSPTWQPPL
FT                   DNRNRPISISFKGLRANQLNSSSNLSALRLSPSDYTVSNSHDLMSERKSVSFSSSIVLF
FT                   STYTEDEYDRHPEVATCNQLTPQLAQIIKEELNTLKAEMEVHEESRCYTHFF"
     MNQSLEEANN DGESYLNDTF YSSTSTDNLE HARTFRNSVL MQDMSGEKPY NPEQEQIPSD        60
     PSDTQGKQYL KSNTNDANDR ETETKTLTVT ASPSLSALAG ILNEKAIQAE KKMRSSMILD       120
     NSIQESIPEE EHSVHNSPVL IDIDGTSDGS YRLKFPPQMA HLQNEIEQPD FLTTPRLDPP       180
     TPRVEPADSD LPNGGQQEKP QEQVSNVSSE REIETQNSNS PKATAERADN SRPLPRKQAS       240
     LRSFSGMSVG SFASNEQPLK ESSSGKKRKS IFSFLKKKPR KNSSLLSQDN SSSATLPTSA       300
     TFSVSKSYHE NDLPASTRLT KNSPSNGSIF STFRKNKASK KEAAAAADRT LHVPKQRATS       360
     GDSNSSNTGG ASQQKRGVQT RKPTPLDFEH VSQKAPSTQH NSPILTEPST ELQNTPQLVV       420
     KSPVPSENKV PDDVGESLLK ADSGGVLFPK SLSAHEVESI VSLERSRSVK SAKRNSLNSH       480
     RVSLTDNMSA KINNDGMFIT EPSAPKLSTP DLTKSPTSSI LRNGTFDTLE SSTQRGSYAE       540
     PNNLGISSAG LRAQDRDFSF TSIEQKLNDI TLDSESEDEL AVNTKKASTS AGENFDTELM       600
     SDIMEFANII DFGKDLDLNL DLSQEDINYK SLNPSDVKQS EKLPRDEMSA DSFNFNSVAQ       660
     VPLSSSGDRQ SFSQHSYRSS IERNDTTNTD RTSFRRHSTL LSPPLNEDTR TEQMRNILSA       720
     DDDDDEFEGE DFNELEEKLE SQTIGSPTWQ PPLDNRNRPI SISFKGLRAN QLNSSSNLSA       780
     LRLSPSDYTV SNSHDLMSER KSVSFSSSIV LFSTYTEDEY DRHPEVATCN QLTPQLAQII       840
     KEELNTLKAE MEVHEESRCY THFF                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page