(data stored in SCRATCH zone)

EMBL: CU928166.PE353

CU928166.PE353       Location/Qualifiers
FT   CDS             complement(687524..688819)
FT                   /locus_tag="KLTH0B08470g"
FT                   /old_locus_tag="KLTH-ORF14740"
FT                   /product="KLTH0B08470p"
FT                   /note="some similarities with uniprot|P53857 Saccharomyces
FT                   cerevisiae YNL234W Similar to globins and has a functional
FT                   heme-binding domain involved in glucose signaling or
FT                   metabolism regulated by Rgt1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08470g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21718"
FT                   /db_xref="GOA:C5DD57"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD57"
FT                   /protein_id="CAR21718.1"
FT                   /translation="MEENRSFYSPLDRSQIAFIPADLESISENDPSVEPSPGLPRLSGD
FT                   SHIFKESFRDSYVPSVTSQSIFSEAHPPSSLSSVDELDRLSSLSSGSSCGTNMSYAARY
FT                   KIVLKLTSREIKLIRESWSMMLNDELSGDNLRTFIRKIVHEIGGLPWVRASGRRTRNNS
FT                   QNTSLSANSSASSPGSGSPPSPKHASAIPTGNTGAFASSIFCQQFYGNLLYMAPSIEAM
FT                   FPSIRHQAVSFAGVLTMTVNNLDNLSALEAYLCALGKRHARILSIEPPHFELMGLAFLK
FT                   TIKERFGVHCTLELEETWSRLYSYLANSILQFGIDPVLKIDALKNEMIFPVLDVTKGLP
FT                   STKSMFQPLQPSALNAHALATQKLRNNSRPENISPLTKPPISSKKSLPISTSNRNISGS
FT                   ALPQQHKKEQQKPKPLGASALKRDSDKDCVIM"
     MEENRSFYSP LDRSQIAFIP ADLESISEND PSVEPSPGLP RLSGDSHIFK ESFRDSYVPS        60
     VTSQSIFSEA HPPSSLSSVD ELDRLSSLSS GSSCGTNMSY AARYKIVLKL TSREIKLIRE       120
     SWSMMLNDEL SGDNLRTFIR KIVHEIGGLP WVRASGRRTR NNSQNTSLSA NSSASSPGSG       180
     SPPSPKHASA IPTGNTGAFA SSIFCQQFYG NLLYMAPSIE AMFPSIRHQA VSFAGVLTMT       240
     VNNLDNLSAL EAYLCALGKR HARILSIEPP HFELMGLAFL KTIKERFGVH CTLELEETWS       300
     RLYSYLANSI LQFGIDPVLK IDALKNEMIF PVLDVTKGLP STKSMFQPLQ PSALNAHALA       360
     TQKLRNNSRP ENISPLTKPP ISSKKSLPIS TSNRNISGSA LPQQHKKEQQ KPKPLGASAL       420
     KRDSDKDCVI M                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page