(data stored in SCRATCH zone)

EMBL: CU928166.PE360

CU928166.PE360       Location/Qualifiers
FT   CDS             700331..702544
FT                   /locus_tag="KLTH0B08646g"
FT                   /old_locus_tag="KLTH-ORF14718"
FT                   /product="KLTH0B08646p"
FT                   /note="weakly similar to uniprot|P38870 Saccharomyces
FT                   cerevisiae YHR182W Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cell periphery and cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08646g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21725"
FT                   /db_xref="GOA:C5DD64"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD64"
FT                   /protein_id="CAR21725.1"
FT                   /translation="MTTEASRATFWSEDYTSGIAVLLGNIDNDVSELQEFIEDVETFDN
FT                   KTVSPAIKSLDSLVRSIPSDTDESLCNKLKQQRKGLLAEILEKLQIANRSNLETACLSQ
FT                   LQALLFEFEEYQQESKELIEKNYGLYSKHLSLAKRARVDVTTRAQRIREASQKPLLRSE
FT                   ETPLSSEEERDYANESSIQFPLTLDAKLSFSSEESFFGFCNKLKKLTKTSKRLIYIPGV
FT                   SNEYFSSSALFESLKRIEPRMDASLYNLERLGQTLINNEIISPYNGILGAKVSFARDGY
FT                   YVWGENSSPVIRPAEEKPLRRADVFNGLFKKIGRSSGSSEQIETTEELGLRQRELVDRE
FT                   DHFFQECQNLDYWRTQLELELQKCMNQYHKMLRHKIQILNKASLQFSSLLKEALSTQSS
FT                   LTPVGADQEIRRIYRANYGIVGHYVPQPGVVFAKHNQLGELTGVAMFHADLQEFPTNEL
FT                   GVAIILHILLEYLWGCDALEVLQAWQLPLDLRRVSRLRRECIVEFKETDGSHSASLANI
FT                   LASKPRPLADVVGLLQSWLLELPDSLIPMICYEEISRTQSIEGMSMAPAEHLVNLAAVC
FT                   DHFRWLVQRCGGEKVRTAFDSRTDFPLYHVFARTRTRNPQEAPVVSGVVHEILCKDESA
FT                   ERLREMAKNSNARTDARAEARADLQAGSSKHSSPPSTSRLATPAVFVPRPLKAAHSDAS
FT                   SSRPSSKRISGLDLAVVGQSDSESETEPKESKEPSTLAAGVAD"
     MTTEASRATF WSEDYTSGIA VLLGNIDNDV SELQEFIEDV ETFDNKTVSP AIKSLDSLVR        60
     SIPSDTDESL CNKLKQQRKG LLAEILEKLQ IANRSNLETA CLSQLQALLF EFEEYQQESK       120
     ELIEKNYGLY SKHLSLAKRA RVDVTTRAQR IREASQKPLL RSEETPLSSE EERDYANESS       180
     IQFPLTLDAK LSFSSEESFF GFCNKLKKLT KTSKRLIYIP GVSNEYFSSS ALFESLKRIE       240
     PRMDASLYNL ERLGQTLINN EIISPYNGIL GAKVSFARDG YYVWGENSSP VIRPAEEKPL       300
     RRADVFNGLF KKIGRSSGSS EQIETTEELG LRQRELVDRE DHFFQECQNL DYWRTQLELE       360
     LQKCMNQYHK MLRHKIQILN KASLQFSSLL KEALSTQSSL TPVGADQEIR RIYRANYGIV       420
     GHYVPQPGVV FAKHNQLGEL TGVAMFHADL QEFPTNELGV AIILHILLEY LWGCDALEVL       480
     QAWQLPLDLR RVSRLRRECI VEFKETDGSH SASLANILAS KPRPLADVVG LLQSWLLELP       540
     DSLIPMICYE EISRTQSIEG MSMAPAEHLV NLAAVCDHFR WLVQRCGGEK VRTAFDSRTD       600
     FPLYHVFART RTRNPQEAPV VSGVVHEILC KDESAERLRE MAKNSNARTD ARAEARADLQ       660
     AGSSKHSSPP STSRLATPAV FVPRPLKAAH SDASSSRPSS KRISGLDLAV VGQSDSESET       720
     EPKESKEPST LAAGVAD                                                      737
//

If you have problems or comments...

PBIL Back to PBIL home page