(data stored in ACNUC8465 zone)

EMBL: CU928166.PE363

CU928166.PE363       Location/Qualifiers
FT   CDS             complement(706712..707746)
FT                   /locus_tag="KLTH0B08712g"
FT                   /old_locus_tag="KLTH-ORF14704"
FT                   /product="KLTH0B08712p"
FT                   /note="similar to uniprot|P53320 Saccharomyces cerevisiae
FT                   YGR257C MTM1 Mitochondrial protein of the mitochondrial
FT                   carrier family involved in activating mitochondrial Sod2p
FT                   probably by facilitating insertion of an essential
FT                   manganese cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08712g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21728"
FT                   /db_xref="GOA:C5DD67"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD67"
FT                   /protein_id="CAR21728.1"
FT                   /translation="MSNEKKEGIGLKERLLSAVAGSLLTSLILTPMDVVRIRLQQQKML
FT                   PSCDCDANGKLSLKTTAPKGVFWQDACFADVHCQTSSVNYNSTWDAFTKIARIEGARSL
FT                   WRGLSITLVMAVPANMVYFIGYESLRDNSFLQNKYSRLNPLLCGAIARVLAATTVAPLE
FT                   LFRTRLQSIPRSSPNSTAAMMVKDLIKESRYEISRVGYKALFRGLEITLWRDVPFSSIY
FT                   WGCYEFYKSNISIKSERSIVNSSNTNWNHFVNSFVGGSFGGAVAAILTHPFDVGKTRMQ
FT                   ISFLNNTPGKSPSKNMFKYLNQIRKSEGLGALYTGLVPRVIKIAPSCAIMISTYEVCKR
FT                   LFST"
     MSNEKKEGIG LKERLLSAVA GSLLTSLILT PMDVVRIRLQ QQKMLPSCDC DANGKLSLKT        60
     TAPKGVFWQD ACFADVHCQT SSVNYNSTWD AFTKIARIEG ARSLWRGLSI TLVMAVPANM       120
     VYFIGYESLR DNSFLQNKYS RLNPLLCGAI ARVLAATTVA PLELFRTRLQ SIPRSSPNST       180
     AAMMVKDLIK ESRYEISRVG YKALFRGLEI TLWRDVPFSS IYWGCYEFYK SNISIKSERS       240
     IVNSSNTNWN HFVNSFVGGS FGGAVAAILT HPFDVGKTRM QISFLNNTPG KSPSKNMFKY       300
     LNQIRKSEGL GALYTGLVPR VIKIAPSCAI MISTYEVCKR LFST                        344
//

If you have problems or comments...

PBIL Back to PBIL home page