(data stored in ACNUC8465 zone)

EMBL: CU928166.PE364

CU928166.PE364       Location/Qualifiers
FT   CDS             complement(707994..708773)
FT                   /locus_tag="KLTH0B08734g"
FT                   /old_locus_tag="KLTH-ORF14703"
FT                   /product="KLTH0B08734p"
FT                   /note="weakly similar to uniprot|P38872 Saccharomyces
FT                   cerevisiae YHR185C PFS1 Sporulation protein required for
FT                   prospore membrane formation at selected spindle poles
FT                   ensures functionality of all four spindle pole bodies of a
FT                   cell during meiosis II not required for meiotic
FT                   recombination or meiotic chromosome segregation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08734g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21729"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD68"
FT                   /protein_id="CAR21729.1"
FT                   /translation="MKAQKSHQQSSRVLAANGSIANIERTGHFPSAKPVCERSPKRRES
FT                   FKVTKSKRLEPGELYSPHADASDKTTGFMSSPVGNIPDSSAVRRVGYANRAYAPGDSPF
FT                   AQYALMNYCNSNSHLNTSIYANPNISSLTGVDHVEQDVNNIFDDFEHFSFQTFPSYFNP
FT                   REASNMPHQEKVNKWIESVPTFNVSGELWESECYSVNTDLDWEEKEFDRGLVCHESLPF
FT                   SLATADEILHLQAKRLDTLVRRNYELTPEVPLTPRAF"
     MKAQKSHQQS SRVLAANGSI ANIERTGHFP SAKPVCERSP KRRESFKVTK SKRLEPGELY        60
     SPHADASDKT TGFMSSPVGN IPDSSAVRRV GYANRAYAPG DSPFAQYALM NYCNSNSHLN       120
     TSIYANPNIS SLTGVDHVEQ DVNNIFDDFE HFSFQTFPSY FNPREASNMP HQEKVNKWIE       180
     SVPTFNVSGE LWESECYSVN TDLDWEEKEF DRGLVCHESL PFSLATADEI LHLQAKRLDT       240
     LVRRNYELTP EVPLTPRAF                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page