(data stored in SCRATCH zone)

EMBL: CU928166.PE365

CU928166.PE365       Location/Qualifiers
FT   CDS             complement(708976..712047)
FT                   /locus_tag="KLTH0B08756g"
FT                   /old_locus_tag="KLTH-ORF14700"
FT                   /product="KLTH0B08756p"
FT                   /note="similar to uniprot|P07276 Saccharomyces cerevisiae
FT                   YGR258C RAD2 Single-stranded DNA endonuclease cleaves
FT                   single-stranded DNA during nucleotide excision repair to
FT                   excise damaged DNA subunit of Nucleotide Excision Repair
FT                   Factor 3 (NEF3) homolog of human XPG protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08756g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21730"
FT                   /db_xref="GOA:C5DD69"
FT                   /db_xref="InterPro:IPR001044"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD69"
FT                   /protein_id="CAR21730.1"
FT                   /translation="MGVHALWDIVGPTAKPVRLESLSNKRLAVDASIWIYQFLKAVRDK
FT                   EGNAMRYSHVVGFFRRICKLLYFGIKPVFVFDGGAPALKRRTIQQRKERRQGRRDNAVS
FT                   TAKKLLALQMQNGDRTKNKENASRSTSQTHVHRQDDEYDLPKIPGFKYEEGDARINADD
FT                   FKTIMENIDELDGVDLDAVNPASREFEELPKSTQYMILSALRLKSRLRMGYSKEQLEEI
FT                   FPDSMEFSKFQIDMVKRRNFFTQKLMSATNTHDGGASKSDTEPYKRVAGQRGKEYQLIR
FT                   TENGWALSLTGNDGSEISKAIVVDEPQRKMEGESRTRSEPQGEDDEDEDIDWEDVDVEK
FT                   KKSEKELDYSIKASMLSVKANTVRSGGGQSFLDRRTTETRDKGPQSKFVYVSNEPELID
FT                   DEDEDEDDFSELTKEIQLMEDVKNGRGKRIEEIQTDNSIPQRQEQQKAESKKPSSSAPF
FT                   SYENEPASVKDRIEVADNSDEVGEQEMITEDEVREKSQQNSRFGEFIAPSYPQNKASHD
FT                   GHPKVSSSQAENKKSSNSEQNLQFVLDKINNLEQMQDQRVEIAPANENPEGHNSDVIHA
FT                   HSRAPEHDERPVQETPAWFRSAPDFNPHLGTSFLTSTTEKEPEQTDDEQLGLLTGSKAA
FT                   ELLYERDVLNKENEANGDQSSAEEDVIEIAPPESLSADKPSEGGEEEEIDSAGTQGKAH
FT                   VPVVDYDFSEDEEDALVHQLREEEQDYNAFKTSLNPSSVNATFVDEELHDQHLRDKRDS
FT                   DEVTAAMVAEVQDLLTRFGIPFMTAPMEAEAQCAELLMLGLVDGIITDDSDIFLFGGDK
FT                   VYKNMFQEKNYVEYYYSDLMKKELGLDREKFIELAQLLGSDYTTGVKSVGPVSAMEILA
FT                   EFGNLHNFRNWYSDGQFNKKKQEEEPTFEKRLRKKLVTSEVILDTEFPSDLVKEAYLRP
FT                   EVDHDATRFTWGVPDLDRLRSFFQSTIGWPQEKTDEVMIPLIREVNNRKKTGIQNTLTN
FT                   FFPSEYIKASKDIKLGKRIKNASGKLKMKKQRTE"
     MGVHALWDIV GPTAKPVRLE SLSNKRLAVD ASIWIYQFLK AVRDKEGNAM RYSHVVGFFR        60
     RICKLLYFGI KPVFVFDGGA PALKRRTIQQ RKERRQGRRD NAVSTAKKLL ALQMQNGDRT       120
     KNKENASRST SQTHVHRQDD EYDLPKIPGF KYEEGDARIN ADDFKTIMEN IDELDGVDLD       180
     AVNPASREFE ELPKSTQYMI LSALRLKSRL RMGYSKEQLE EIFPDSMEFS KFQIDMVKRR       240
     NFFTQKLMSA TNTHDGGASK SDTEPYKRVA GQRGKEYQLI RTENGWALSL TGNDGSEISK       300
     AIVVDEPQRK MEGESRTRSE PQGEDDEDED IDWEDVDVEK KKSEKELDYS IKASMLSVKA       360
     NTVRSGGGQS FLDRRTTETR DKGPQSKFVY VSNEPELIDD EDEDEDDFSE LTKEIQLMED       420
     VKNGRGKRIE EIQTDNSIPQ RQEQQKAESK KPSSSAPFSY ENEPASVKDR IEVADNSDEV       480
     GEQEMITEDE VREKSQQNSR FGEFIAPSYP QNKASHDGHP KVSSSQAENK KSSNSEQNLQ       540
     FVLDKINNLE QMQDQRVEIA PANENPEGHN SDVIHAHSRA PEHDERPVQE TPAWFRSAPD       600
     FNPHLGTSFL TSTTEKEPEQ TDDEQLGLLT GSKAAELLYE RDVLNKENEA NGDQSSAEED       660
     VIEIAPPESL SADKPSEGGE EEEIDSAGTQ GKAHVPVVDY DFSEDEEDAL VHQLREEEQD       720
     YNAFKTSLNP SSVNATFVDE ELHDQHLRDK RDSDEVTAAM VAEVQDLLTR FGIPFMTAPM       780
     EAEAQCAELL MLGLVDGIIT DDSDIFLFGG DKVYKNMFQE KNYVEYYYSD LMKKELGLDR       840
     EKFIELAQLL GSDYTTGVKS VGPVSAMEIL AEFGNLHNFR NWYSDGQFNK KKQEEEPTFE       900
     KRLRKKLVTS EVILDTEFPS DLVKEAYLRP EVDHDATRFT WGVPDLDRLR SFFQSTIGWP       960
     QEKTDEVMIP LIREVNNRKK TGIQNTLTNF FPSEYIKASK DIKLGKRIKN ASGKLKMKKQ      1020
     RTE                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page