(data stored in ACNUC8465 zone)

EMBL: CU928166.PE367

CU928166.PE367       Location/Qualifiers
FT   CDS             717544..718431
FT                   /locus_tag="KLTH0B08822g"
FT                   /old_locus_tag="KLTH-ORF14695"
FT                   /product="KLTH0B08822p"
FT                   /note="similar to uniprot|P38874 Saccharomyces cerevisiae
FT                   YHR187W IKI1 Subunit of the Elp4p-Iki1p-Elp6p- subcomplex
FT                   of RNA polymerase II elongator complex which is a histone
FT                   acetyltransferase iki1 mutations confer resistance to the
FT                   K. lactis toxin zymocin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08822g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21732"
FT                   /db_xref="GOA:C5DD71"
FT                   /db_xref="InterPro:IPR019519"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD71"
FT                   /protein_id="CAR21732.1"
FT                   /translation="MASSSHNPAVLLKRVLSLRESSPFILCVDCIERSASSIVEEVSRE
FT                   VGDSATIIYVSYETNNKPRYATHFVEGTGSEARLLDTIKSYLPSKPSPRKHLVIIDTLN
FT                   LIPNNKLSQFISSMVSPSVVLLGIYHKQQPEVRPSSMENYPSSLQLLQFMATSILDCQP
FT                   ITEDAAAEEMLDSKIQKLVIPRGLNSPVFKLVLTNRRKSGRALTYSFQFDSRNHTYNVL
FT                   QEQAENENTEDDKEVFEGLTTFNLNISNRQKAARENVALPFLEAQSFNAGGAIVYEYEK
FT                   DDDYDEEDPYEDPF"
     MASSSHNPAV LLKRVLSLRE SSPFILCVDC IERSASSIVE EVSREVGDSA TIIYVSYETN        60
     NKPRYATHFV EGTGSEARLL DTIKSYLPSK PSPRKHLVII DTLNLIPNNK LSQFISSMVS       120
     PSVVLLGIYH KQQPEVRPSS MENYPSSLQL LQFMATSILD CQPITEDAAA EEMLDSKIQK       180
     LVIPRGLNSP VFKLVLTNRR KSGRALTYSF QFDSRNHTYN VLQEQAENEN TEDDKEVFEG       240
     LTTFNLNISN RQKAARENVA LPFLEAQSFN AGGAIVYEYE KDDDYDEEDP YEDPF            295
//

If you have problems or comments...

PBIL Back to PBIL home page