(data stored in SCRATCH zone)

EMBL: CU928166.PE368

CU928166.PE368       Location/Qualifiers
FT   CDS             complement(718586..720562)
FT                   /locus_tag="KLTH0B08844g"
FT                   /old_locus_tag="KLTH-ORF14693"
FT                   /product="KLTH0B08844p"
FT                   /note="similar to uniprot|P38875 Saccharomyces cerevisiae
FT                   YHR188C GPI16 Transmembrane protein subunit of the
FT                   glycosylphosphatidylinositol transamidase complex that adds
FT                   GPIs to newly synthesized proteins human PIG-Tp homolog"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08844g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21733"
FT                   /db_xref="GOA:C5DD72"
FT                   /db_xref="InterPro:IPR007245"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD72"
FT                   /protein_id="CAR21733.1"
FT                   /translation="MRALLVLFWAFLVAKAQEVRSSIDEELLIPNETESAGSADETCIA
FT                   EDSSFGLDSGNSTSNDKEDPVEEELLNEALQKPVFFEKQDAIKYPFAEQLTLKPLPRNY
FT                   MVASFQFQMASNNLSVGQSETDFDAYRHYTVFPKAISPILEYTNTRQLHLRFTHGLWDS
FT                   ESWGQLPHKGSKSGGNGVELWAVIEADSKEIAFRHWVSLANSLSGLFCSSINFIDSERT
FT                   TYPVSSFQPQGDGGLPVFNATNGLFLIRAALANEPICTENLTPFLKLLPTRGKSGISSL
FT                   LDGHKVFDSNWHSMSLDVETTCDGNDCKYHMEELIEIVFNVPNTLARAEKPIPKPVKES
FT                   DLKCDESKPHDNFECFPLPQSKEIKFRLSELFGKQIVGSSLISESPSQICADVSDNWKA
FT                   YIDVDNMLFATDNNCFSVKENKLHDLYLESDDTTQVTPPESVPLYVSRSLTGYGQDSGG
FT                   LRTVFKNPGNESVNAIYFEALPWYMRIYLSSLKIESADGLEIEDVVRGTYYLPAIDRER
FT                   PTHLEYNLTIPANTTIALSYQFDKALLKYAEYPPDANHGFEIESAVVTVLEPVRYEMRT
FT                   ATLLLSLSTPDFSMPYNVIILTSTVMGLAFGTLFNLMVKRLVPLEEADRQASLRPGLKG
FT                   KVARMLKAFSLKRKKVDEVKKRQ"
     MRALLVLFWA FLVAKAQEVR SSIDEELLIP NETESAGSAD ETCIAEDSSF GLDSGNSTSN        60
     DKEDPVEEEL LNEALQKPVF FEKQDAIKYP FAEQLTLKPL PRNYMVASFQ FQMASNNLSV       120
     GQSETDFDAY RHYTVFPKAI SPILEYTNTR QLHLRFTHGL WDSESWGQLP HKGSKSGGNG       180
     VELWAVIEAD SKEIAFRHWV SLANSLSGLF CSSINFIDSE RTTYPVSSFQ PQGDGGLPVF       240
     NATNGLFLIR AALANEPICT ENLTPFLKLL PTRGKSGISS LLDGHKVFDS NWHSMSLDVE       300
     TTCDGNDCKY HMEELIEIVF NVPNTLARAE KPIPKPVKES DLKCDESKPH DNFECFPLPQ       360
     SKEIKFRLSE LFGKQIVGSS LISESPSQIC ADVSDNWKAY IDVDNMLFAT DNNCFSVKEN       420
     KLHDLYLESD DTTQVTPPES VPLYVSRSLT GYGQDSGGLR TVFKNPGNES VNAIYFEALP       480
     WYMRIYLSSL KIESADGLEI EDVVRGTYYL PAIDRERPTH LEYNLTIPAN TTIALSYQFD       540
     KALLKYAEYP PDANHGFEIE SAVVTVLEPV RYEMRTATLL LSLSTPDFSM PYNVIILTST       600
     VMGLAFGTLF NLMVKRLVPL EEADRQASLR PGLKGKVARM LKAFSLKRKK VDEVKKRQ         658
//

If you have problems or comments...

PBIL Back to PBIL home page